• Gene id: 11082

Gene Summary

• Gene Symbol: ESM1   Gene   UCSC   Ensembl
• Aliases: endocan
• Gene name: endothelial cell specific molecule 1
• Alternate names: endothelial cell-specific molecule 1, ESM-1,
• Gene location: 5q11.2 (54985592: 54977866)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disor
• OMIM: 146929

Protein Summary

• Protein general information: Q9NQ30  
  • Name: Endothelial cell specific molecule 1 (ESM 1)
  • Length: 184  
  • Mass: 20095
  • Tissue specificity: Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney.
• Sequence:

  MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGM
  KCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLT
  EHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR

• Structural information:
  • Protein Domains: (24..10-)
    (/note="IGFBP-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00653"-)
  • Interpro: IPR038850  IPR009030  IPR000867  
  • Prosite: PS51323
  • STRING: ENSP00000370812
• Other Databases: GeneCards:  ESM1  Malacards:  ESM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IBA	biological process
GO:1902204	positive regulation of hepatocyte growth factor receptor signaling pathway	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005171	hepatocyte growth factor receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005520	insulin-like growth factor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:1902204	positive regulation of hepatocyte growth factor receptor signaling pathway	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0001525	angiogenesis	IEP	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0005171	hepatocyte growth factor receptor binding	IPI	molecular function
GO:0002040	sprouting angiogenesis	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881