• Gene id: 11080

Gene Summary

• Gene Symbol: DNAJB4   Gene   UCSC   Ensembl
• Aliases: DNAJW, DjB4, HLJ1
• Gene name: DnaJ heat shock protein family (Hsp40) member B4
• Alternate names: dnaJ homolog subfamily B member 4, DnaJ (Hsp40) homolog, subfamily B, member 4, DnaJ-like heat shock protein 40, HSP40 homolog, heat shock 40 kDa protein 1 homolog, heat shock protein 40 homolog, human liver DnaJ-like protein,
• Gene location: 1p31.1 (77979157: 78017963)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds inco
• OMIM: 611327

Protein Summary

• Protein general information: Q9UDY4  
  • Name: DnaJ homolog subfamily B member 4 (Heat shock 40 kDa protein 1 homolog) (HSP40 homolog) (Heat shock protein 40 homolog) (Human liver DnaJ like protein)
  • Length: 337  
  • Mass: 37807
  • Tissue specificity: Expressed in heart, pancreas and skeletal muscle, and to a lesser extent in brain, placenta and liver. {ECO
• Sequence:

  MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGG
  AGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVG
  PSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPN
  SIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPF
  PKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS

• Structural information:
  • Protein Domains: (2..7-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR002939  IPR001623  IPR018253  IPR008971  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • STRING: ENSP00000359799
• Other Databases: GeneCards:  DNAJB4  Malacards:  DNAJB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0051087	chaperone binding	IBA	molecular function
GO:0001671	ATPase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0006986	response to unfolded protein	TAS	biological process
GO:0009408	response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032781	positive regulation of ATPase activity	IEA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function
GO:0051087	chaperone binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R