• Gene id: 11076

Gene Summary

• Gene Symbol: TPPP   Gene   UCSC   Ensembl
• Aliases: TPPP/p25, TPPP1, p24, p25, p25alpha
• Gene name: tubulin polymerization promoting protein
• Alternate names: tubulin polymerization-promoting protein, 25 kDa brain-specific protein, brain specific protein p25 alpha, glycogen synthase kinase 3 (GSK3) inhibitor p24, p25-alpha,
• Gene location: 5p15.33 (700726: 659861)     Exons: 7     NC_000005.10

Protein Summary

• Protein general information: O94811  
  • Name: Tubulin polymerization promoting protein (TPPP) (EC 3.6.5. ) (25 kDa brain specific protein) (TPPP/p25) (p24) (p25 alpha)
  • Length: 219  
  • Mass: 23694
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKN
  WSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPI
  ISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

• Structural information:
  • Interpro: IPR011992  IPR008907  IPR030792  
  • STRING: ENSP00000353785
• Other Databases: GeneCards:  TPPP  Malacards:  TPPP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	ISS	molecular function
GO:0015631	tubulin binding	ISS	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031334	positive regulation of protein-containing complex assembly	ISS	biological process
GO:0032273	positive regulation of protein polymerization	IDA	biological process
GO:0001578	microtubule bundle formation	ISS	biological process
GO:0046785	microtubule polymerization	ISS	biological process
GO:0015631	tubulin binding	IBA	molecular function
GO:0001578	microtubule bundle formation	IBA	biological process
GO:0005874	microtubule	IBA	colocalizes with
GO:0032273	positive regulation of protein polymerization	IBA	biological process
GO:0046785	microtubule polymerization	IBA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:1904428	negative regulation of tubulin deacetylation	IDA	biological process
GO:1904428	negative regulation of tubulin deacetylation	IDA	biological process
GO:0015631	tubulin binding	IDA	molecular function
GO:0051418	microtubule nucleation by microtubule organizing center	IDA	biological process
GO:0001578	microtubule bundle formation	IDA	biological process
GO:0030953	astral microtubule organization	IDA	biological process
GO:0072686	mitotic spindle	IDA	cellular component
GO:0070507	regulation of microtubule cytoskeleton organization	IDA	biological process
GO:0046785	microtubule polymerization	IDA	biological process
GO:0005874	microtubule	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0001578	microtubule bundle formation	IDA	biological process
GO:0032288	myelin assembly	ISS	biological process
GO:0031643	positive regulation of myelination	ISS	biological process
GO:0150051	postsynaptic Golgi apparatus	ISS	cellular component
GO:0014003	oligodendrocyte development	ISS	biological process
GO:0048709	oligodendrocyte differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015631	tubulin binding	IEA	molecular function
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0046785	microtubule polymerization	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032288	myelin assembly	IEA	biological process
GO:0031643	positive regulation of myelination	IEA	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0046785	microtubule polymerization	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0150051	postsynaptic Golgi apparatus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0097427	microtubule bundle	IDA	colocalizes with

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R