• Gene id: 11074

Gene Summary

• Gene Symbol: TRIM31   Gene   UCSC   Ensembl
• Aliases: C6orf13, HCG1, HCGI, RNF
• Gene name: tripartite motif containing 31
• Alternate names: E3 ubiquitin-protein ligase TRIM31, RING-type E3 ubiquitin transferase TRIM31, tripartite motif-containing protein 31,
• Gene location: 6p22.1 (30113089: 30102891)     Exons: 10     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by R
• OMIM: 618812

Protein Summary

• Protein general information: Q9BZY9  
  • Name: E3 ubiquitin protein ligase TRIM31 (EC 2.3.2.27) (RING type E3 ubiquitin transferase TRIM31) (Tripartite motif containing protein 31)
  • Length: 425  
  • Mass: 48244
  • Tissue specificity: Up-regulated in gastric adenocarcinomas. {ECO
• Sequence:

  MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLV
  EKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQ
  QKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQL
  NDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
  RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVC
  LLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS

• Structural information:
  • Interpro: IPR000315  IPR020457  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50119 PS00518 PS50089
  • CDD: cd00021
  • PDB: 2YSJ 2YSL
  • PDBsum: 2YSJ 2YSL
  • STRING: ENSP00000365924
• Other Databases: GeneCards:  TRIM31  Malacards:  TRIM31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0016604	nuclear body	IBA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IMP	biological process
GO:1902186	regulation of viral release from host cell	IMP	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0045087	innate immune response	IMP	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray