• Gene id: 11072

Gene Summary

• Gene Symbol: DUSP14   Gene   UCSC   Ensembl
• Aliases: MKP-L, MKP6
• Gene name: dual specificity phosphatase 14
• Alternate names: dual specificity protein phosphatase 14, MAP kinase phosphatase 6, MKP-1-like protein tyrosine phosphatase, MKP-6, mitogen-activated protein kinase phosphatase 6,
• Gene location: 17q12 (37488560: 37513500)     Exons: 5     NC_000017.11
• Gene summary(Entrez): Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues.
• OMIM: 606618

Protein Summary

• Protein general information: O95147  
  • Name: Dual specificity protein phosphatase 14 (EC 3.1.3.16) (EC 3.1.3.48) (MKP 1 like protein tyrosine phosphatase) (MKP L) (Mitogen activated protein kinase phosphatase 6) (MAP kinase phosphatase 6) (MKP 6)
  • Length: 198  
  • Mass: 22255
• Sequence:

  MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVK
  VPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRP
  NVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

• Structural information:
  • Protein Domains: (91..15-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR020420  IPR000340  IPR029021  IPR016130   IPR000387  IPR020422  
  • Prosite: PS00383 PS50056 PS50054
  • PDB: 2WGP
  • PDBsum: 2WGP
  • STRING: ENSP00000477653
• Other Databases: GeneCards:  DUSP14  Malacards:  DUSP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0000188	inactivation of MAPK activity	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881