• Gene id: 11067

Gene Summary

• Gene Symbol: DEPP1   Gene   UCSC   Ensembl
• Aliases: C10orf10, DEPP, FIG, Fseg
• Gene name: DEPP1 autophagy regulator
• Alternate names: protein DEPP1, decidual protein induced by progesterone, fasting induced, fasting-induced gene protein, fasting-induced protein, fat-specific expressed, protein DEPP,
• Gene location: 10q11.21 (44978808: 44976127)     Exons: 2     NC_000010.11
• Gene summary(Entrez): The expression of this gene is induced by fasting as well as by progesterone. The protein encoded by this gene contains a t-synaptosome-associated protein receptor (SNARE) coiled-coil homology domain and a peroxisomal targeting signal. Production of the e
• OMIM: 603704

Protein Summary

• Protein general information: Q9NTK1  
  • Name: Protein DEPP1 (Decidual protein induced by progesterone) (Fasting induced gene protein) (FIG)
  • Length: 212  
  • Mass: 23406
  • Tissue specificity: Expressed in various tissues, including pancreas, placenta, ovary, testis and kidney. {ECO
• Sequence:

  MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRK
  GRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRG
  RLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL

• Structural information:
  • Interpro: IPR020133  
  • STRING: ENSP00000298295
• Other Databases: GeneCards:  DEPP1  Malacards:  DEPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0010506	regulation of autophagy	IDA	biological process
GO:0005777	peroxisome	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881