• Gene id: 11066

Gene Summary

• Gene Symbol: SNRNP35   Gene   UCSC   Ensembl
• Aliases: HM-1, U1SNRNPBP
• Gene name: small nuclear ribonucleoprotein U11/U12 subunit 35
• Alternate names: U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U1 snRNP-binding protein homolog, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), small nuclear ribonucleoprotein, U11/U12 35kDa ,
• Gene location: 12q24.31 (123458100: 123473153)     Exons: 8     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing facto

Protein Summary

• Protein general information: Q16560  
  • Name: U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12 snRNP 35 kDa protein) (U11/U12 35K) (Protein HM 1) (U1 snRNP binding protein homolog)
  • Length: 246  
  • Mass: 29450
  • Tissue specificity: Expressed in heart, liver, skeletal muscle and pancreas. {ECO
• Sequence:

  MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYG
  DIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKES
  GQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKRWQEREPTRVWPDNDW
  ERERDFRDDRIKGREKKERGK

• Structural information:
  • Protein Domains: (51..12-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR034146  
  • Prosite: PS50102
  • CDD: cd12237
  • STRING: ENSP00000403310
• Other Databases: GeneCards:  SNRNP35  Malacards:  SNRNP35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008380	RNA splicing	IC	biological process
GO:0005689	U12-type spliceosomal complex	IDA	cellular component
GO:0005689	U12-type spliceosomal complex	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0017069	snRNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881