• Gene id: 11065

Gene Summary

• Gene Symbol: UBE2C   Gene   UCSC   Ensembl
• Aliases: UBCH10, dJ447F3.2
• Gene name: ubiquitin conjugating enzyme E2 C
• Alternate names: ubiquitin-conjugating enzyme E2 C, (E3-independent) E2 ubiquitin-conjugating enzyme C, E2 ubiquitin-conjugating enzyme C, cyclin-selective ubiquitin carrier protein, mitotic-specific ubiquitin-conjugating enzyme, ubiquitin conjugating enzyme E2C, ubiquitin-prot,
• Gene location: 20q13.12 (45812575: 45816956)     Exons: 8     NC_000020.11
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating e
• OMIM: 600984

Protein Summary

• Protein general information: O00762  
  • Name: Ubiquitin conjugating enzyme E2 C (EC 2.3.2.23) ((E3 independent) E2 ubiquitin conjugating enzyme C) (EC 2.3.2.24) (E2 ubiquitin conjugating enzyme C) (UbcH10) (Ubiquitin carrier protein C) (Ubiquitin protein ligase C)
  • Length: 179  
  • Mass: 19652
• Sequence:

  MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYE
  DLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT
  HAAELWKNPTAFKKYLQETYSKQVTSQEP

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1I7K 4YII 5A31 5KHR 5L9U
  • PDBsum: 1I7K 4YII 5A31 5KHR 5L9U
  • DIP: 52725
  • STRING: ENSP00000348838
• Other Databases: GeneCards:  UBE2C  Malacards:  UBE2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0031145	anaphase-promoting complex-dependent catabolic process	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0030071	regulation of mitotic metaphase/anaphase transition	IBA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0010994	free ubiquitin chain polymerization	IDA	biological process
GO:0010458	exit from mitosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	TAS	biological process
GO:0051301	cell division	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0061631	ubiquitin conjugating enzyme activity	IDA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0070936	protein K48-linked ubiquitination	IDA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0031145	anaphase-promoting complex-dependent catabolic process	IDA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0031536	positive regulation of exit from mitosis	IMP	biological process
GO:0044389	ubiquitin-like protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray