• Gene id: 11061

Gene Summary

• Gene Symbol: CNMD   Gene   UCSC   Ensembl
• Aliases: BRICD3, CHM-I, CHM1, LECT1, MYETS1
• Gene name: chondromodulin
• Alternate names: leukocyte cell-derived chemotaxin 1, BRICHOS domain containing 3, chondromodulin-1, chondromodulin-I, leukocyte cell derived chemotaxin 1, multiple myeloma tumor suppressor 1,
• Gene location: 13q14.3 (52739819: 52703263)     Exons: 7     NC_000013.11
• Gene summary(Entrez): This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein alth
• OMIM: 605147

Protein Summary

• Protein general information: O75829  
  • Name: Leukocyte cell derived chemotaxin 1 (Chondromodulin) [Cleaved into: Chondrosurfactant protein (CH SP); Chondromodulin 1 (Chondromodulin I) (ChM I)]
  • Length: 334  
  • Mass: 37102
  • Tissue specificity: Detected in cartilage and cardiac valves (at protein level). Detected in the laminae fibrosa, spongiosa and ventricularis layers of normal cardiac valves (at protein level). Expression is decreased cardiac valves of patients with valvu
• Sequence:

  MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNV
  HYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQ
  SISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTT
  KRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL
  GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV

• Structural information:
  • Protein Domains: (104..20-)
    (/note="BRICHOS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00255"-)
  • Interpro: IPR007084  
  • Prosite: PS50869
  • STRING: ENSP00000367198
• Other Databases: GeneCards:  CNMD  Malacards:  CNMD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001886	endothelial cell morphogenesis	IBA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IBA	biological process
GO:0016525	negative regulation of angiogenesis	IBA	biological process
GO:0030948	negative regulation of vascular endothelial growth factor receptor signaling pathway	IBA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0006029	proteoglycan metabolic process	TAS	biological process
GO:0001501	skeletal system development	TAS	biological process
GO:0012505	endomembrane system	IEA	cellular component
GO:0016525	negative regulation of angiogenesis	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray