• Gene id: 11054

Gene Summary

• Gene Symbol: OGFR   Gene   UCSC   Ensembl
• Gene name: opioid growth factor receptor
• Alternate names: opioid growth factor receptor, protein 7-60, zeta-type opioid receptor,
• Gene location: 20q13.33 (62804834: 62813999)     Exons: 7     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a receptor for opioid growth factor (OGF), also known as [Met(5)]-enkephalin. OGF is a negative regulator of cell proliferation and tissue organization in a variety of processes. The encoded unbound receptor for OGF has
• OMIM: 606459

Protein Summary

• Protein general information: Q9NZT2  
  • Name: Opioid growth factor receptor (OGFr) (Protein 7 60) (Zeta type opioid receptor)
  • Length: 677  
  • Mass: 73325
  • Tissue specificity: Highly expressed in the heart and liver, moderately in skeletal muscle and kidney and to a lesser extent in brain and pancreas. Expressed in fetal tissues including liver and kidney.
• Sequence:

  MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATRDMCRY
  RHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREPGVNWHAKPLT
  LREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNNLRITRILKSLGELGL
  EHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRPRCKFVWGPQDKLRRFKPSSL
  PHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSVEPQDAGPLERSQGDEAGGHGEDRPE
  PLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALSQGSLRTGTQEVGGQDPGEAVQPCRQPLGAR
  VADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGHPKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPS
  PAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSE
  TPGPRPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSG
  KP

• Structural information:
  • Interpro: IPR006757  IPR006770  IPR039574  
  • STRING: ENSP00000290291
• Other Databases: GeneCards:  OGFR  Malacards:  OGFR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0004985	opioid receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0038003	opioid receptor signaling pathway	IEA	biological process
GO:0038003	opioid receptor signaling pathway	IEA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0001558	regulation of cell growth	NAS	biological process
GO:0004985	opioid receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)