• Gene id: 11052

Gene Summary

• Gene Symbol: CPSF6   Gene   UCSC   Ensembl
• Aliases: CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
• Gene name: cleavage and polyadenylation specific factor 6
• Alternate names: cleavage and polyadenylation specificity factor subunit 6, CPSF 68 kDa subunit, cleavage and polyadenylation specific factor 6, 68kDa, cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage factor Im complex 68 kDa subunit, pre-mRNA cleavage ,
• Gene location: 12q15 (69239567: 69274357)     Exons: 11     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and

Protein Summary

• Protein general information: Q16630  
  • Name: Cleavage and polyadenylation specificity factor subunit 6 (Cleavage and polyadenylation specificity factor 68 kDa subunit) (CPSF 68 kDa subunit) (Cleavage factor Im complex 68 kDa subunit) (CFIm68) (Pre mRNA cleavage factor Im 68 kDa subunit) (Protein HPB
  • Length: 551  
  • Mass: 59210
• Sequence:

  MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYT
  YTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELH
  GQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGG
  PPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV
  PGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNSGMPTSDS
  RGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVT
  AISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERS
  RERERHRDRDRDRDRERDREREYRHR

• Structural information:
  • Protein Domains: (81..16-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034769  IPR034772  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 3P5T 3P6Y 3Q2S 3Q2T 4B4N 4U0A 4U0B 4WYM 6AY9 6GX9
  • PDBsum: 3P5T 3P6Y 3Q2S 3Q2T 4B4N 4U0A 4U0B 4WYM 6AY9 6GX9
  • DIP: 34501
  • STRING: ENSP00000266679
• Other Databases: GeneCards:  CPSF6  Malacards:  CPSF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0051262	protein tetramerization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0042382	paraspeckles	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035061	interchromatin granule	IDA	cellular component
GO:0005726	perichromatin fibrils	IDA	cellular component
GO:1990448	exon-exon junction complex binding	IDA	molecular function
GO:1990120	messenger ribonucleoprotein complex assembly	IDA	biological process
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043023	ribosomal large subunit binding	IDA	molecular function
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046833	positive regulation of RNA export from nucleus	IMP	biological process
GO:0098789	pre-mRNA cleavage required for polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005849	mRNA cleavage factor complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0042382	paraspeckles	IDA	cellular component
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0006397	mRNA processing	IDA	biological process
GO:0003723	RNA binding	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray