• Gene id: 11051

Gene Summary

• Gene Symbol: NUDT21   Gene   UCSC   Ensembl
• Aliases: CFIM25, CPSF5
• Gene name: nudix hydrolase 21
• Alternate names: cleavage and polyadenylation specificity factor subunit 5, CPSF 25 kDa subunit, cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, cleavage and polyadenylation specificity factor 25 kDa subun,
• Gene location: 16q13 (42074243: 42079437)     Exons: 3     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and
• OMIM: 604978

Protein Summary

• Protein general information: O43809  
  • Name: Cleavage and polyadenylation specificity factor subunit 5 (Cleavage and polyadenylation specificity factor 25 kDa subunit) (CPSF 25 kDa subunit) (Cleavage factor Im complex 25 kDa subunit) (CFIm25) (Nucleoside diphosphate linked moiety X motif 21) (Nudix
  • Length: 227  
  • Mass: 26227
  • Tissue specificity: Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIG
  MRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWR
  PNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFI
  YN

• Structural information:
  • Protein Domains: (76..20-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR016706  IPR015797  IPR000086  
  • Prosite: PS51462
  • PDB: 2CL3 2J8Q 3BAP 3BHO 3MDG 3MDI 3N9U 3P5T 3P6Y 3Q2S 3Q2T
  • PDBsum: 2CL3 2J8Q 3BAP 3BHO 3MDG 3MDI 3N9U 3P5T 3P6Y 3Q2S 3Q2T
  • DIP: 42502
  • STRING: ENSP00000300291
• Other Databases: GeneCards:  NUDT21  Malacards:  NUDT21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006397	mRNA processing	IBA	biological process
GO:0017091	AU-rich element binding	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0005849	mRNA cleavage factor complex	IBA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:1990120	messenger ribonucleoprotein complex assembly	IDA	biological process
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0051262	protein tetramerization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031439	positive regulation of mRNA cleavage	IDA	biological process
GO:1900365	positive regulation of mRNA polyadenylation	IDA	biological process
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000975	positive regulation of pro-B cell differentiation	ISS	biological process
GO:2000738	positive regulation of stem cell differentiation	ISS	biological process
GO:0010608	posttranscriptional regulation of gene expression	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098789	pre-mRNA cleavage required for polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0005849	mRNA cleavage factor complex	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006378	mRNA polyadenylation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000975	positive regulation of pro-B cell differentiation	IEA	biological process
GO:2000738	positive regulation of stem cell differentiation	IEA	biological process
GO:0010608	posttranscriptional regulation of gene expression	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003682	chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0042382	paraspeckles	IDA	cellular component
GO:0003723	RNA binding	IDA	contributes to
GO:0006397	mRNA processing	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray