• Gene id: 11047

Gene Summary

• Gene Symbol: ADRM1   Gene   UCSC   Ensembl
• Aliases: ARM-1, ARM1, GP110
• Gene name: adhesion regulating molecule 1
• Alternate names: proteasomal ubiquitin receptor ADRM1, 110 kDa cell membrane glycoprotein, M(r) 110,000 surface antigen, proteasome regulatory particle non-ATPase 13, proteasome ubiquitin receptor, rpn13 homolog,
• Gene location: 20q13.33 (62302060: 62308861)     Exons: 8     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5.
• OMIM: 610650

Protein Summary

• Protein general information: Q16186  
  • Name: Proteasomal ubiquitin receptor ADRM1 (110 kDa cell membrane glycoprotein) (Gp110) (Adhesion regulating molecule 1) (ARM 1) (Proteasome regulatory particle non ATPase 13) (hRpn13) (Rpn13 homolog)
  • Length: 407  
  • Mass: 42153
• Sequence:

  MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVEDDLII
  FPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGASGSSGHELSAL
  GGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSST
  RATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
  LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVE
  AFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

• Structural information:
  • Interpro: IPR006773  IPR038633  IPR032368  IPR038108  
  • PDB: 2KQZ 2KR0 2L5V 2MKZ 2NBV 4UEL 4UEM 4WLQ 4WLR 5IRS 5V1Y 5V1Z 5YMY 6CO4 6OI4
  • PDBsum: 2KQZ 2KR0 2L5V 2MKZ 2NBV 4UEL 4UEM 4WLQ 4WLR 5IRS 5V1Y 5V1Z 5YMY 6CO4 6OI4
  • DIP: 42668
  • STRING: ENSP00000478877
• Other Databases: GeneCards:  ADRM1  Malacards:  ADRM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0061133	endopeptidase activator activity	IBA	molecular function
GO:0008541	proteasome regulatory particle, lid subcomplex	IBA	cellular component
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0070628	proteasome binding	IBA	molecular function
GO:0070628	proteasome binding	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000502	proteasome complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0010950	positive regulation of endopeptidase activity	IEA	biological process
GO:0010950	positive regulation of endopeptidase activity	IEA	biological process
GO:0000502	proteasome complex	IDA	cellular component
GO:0061133	endopeptidase activator activity	IDA	molecular function
GO:0043248	proteasome assembly	IDA	biological process
GO:0000502	proteasome complex	IDA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa05169	Epstein-Barr virus infection
hsa05017	Spinocerebellar ataxia
hsa03050	Proteasome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq