• Gene id: 11044

Gene Summary

• Gene Symbol: TENT4A   Gene   UCSC   Ensembl
• Aliases: LAK-1, LAK1, PAPD7, POLK, POLS, TRF4, TRF4-1, TRF41, TUTASE5
• Gene name: terminal nucleotidyltransferase 4A
• Alternate names: terminal nucleotidyltransferase 4A, DNA polymerase kappa, DNA polymerase sigma, PAP-associated domain-containing protein 7, TRAMP-like complex polyadenylate polymerase, non-canonical poly(A) RNA polymerase PAPD7, poly(A) RNA polymerase D7, non-canonical, polymer,
• Gene location: 5p15.31 (6713431: 6757044)     Exons: 15     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a DNA polymerase that is likely involved in DNA repair. In addition, the encoded protein may be required for sister chromatid adhesion. Alternatively spliced transcript variants that encode different isoforms have been
• OMIM: 616637

Protein Summary

• Protein general information: Q5XG87  
  • Name: Terminal nucleotidyltransferase 4A (DNA polymerase sigma) (LAK 1) (Non canonical poly(A) RNA polymerase PAPD7) (EC 2.7.7.19) (PAP associated domain containing protein 7) (TRAMP like complex polyadenylate polymerase) (Terminal guanylyltransferase) (EC 2.7.
  • Length: 772  
  • Mass: 82360
• Sequence:

  MQIWETSQGVGRGGSGFASYFCLNSPALDTAAAAGAAGRGSGGLGPALPAASPPPPGPTAPAALPPALLTALGPA
  AEGARRLHKSPSLSSSSSSSSSNAESGTESPGCSSSSSSSASLGRPGGGRGGAFFNFADGAPSAPGTANGHPGPR
  GPAPAGSPSQHQFHPGRRKRENKASTYGLNYLLSGSRAAALSGGGGPGAQAPRPGTPWKSRAYSPGIQGLHEEII
  DFYNFMSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK
  HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNE
  VFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMT
  SGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYR
  RWIKEKWGSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDV
  DSDTPPCTTPSVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGV
  EGTASLKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYN
  RTGWRRKKHTHTRDSLPVSLSR

• Structural information:
  • Protein Domains: (408..46-)
    (/note="PAP-associated"-)
  • Interpro: IPR002058  IPR002934  IPR040137  
  • STRING: ENSP00000230859
• Other Databases: GeneCards:  TENT4A  Malacards:  TENT4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0071044	histone mRNA catabolic process	IBA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IBA	molecular function
GO:0031499	TRAMP complex	IBA	cellular component
GO:0071050	snoRNA polyadenylation	IBA	biological process
GO:0070568	guanylyltransferase activity	IMP	molecular function
GO:1905870	positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	biological process
GO:0060212	negative regulation of nuclear-transcribed mRNA poly(A) tail shortening	IMP	biological process
GO:0071076	RNA 3' uridylation	IMP	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0043631	RNA polyadenylation	IEA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0004652	polynucleotide adenylyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0042493	response to drug	IDA	biological process
GO:0006302	double-strand break repair	NAS	biological process
GO:0007062	sister chromatid cohesion	TAS	biological process
GO:0043221	SMC family protein binding	TAS	molecular function
GO:0007076	mitotic chromosome condensation	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881