• Gene id: 11043

Gene Summary

• Gene Symbol: MID2   Gene   UCSC   Ensembl
• Aliases: FXY2, MRX101, RNF60, TRIM1
• Gene name: midline 2
• Alternate names: probable E3 ubiquitin-protein ligase MID2, RING finger protein 60, RING-type E3 ubiquitin transferase MID2, midin 2, midline defect 2, tripartite motif protein 1, tripartite motif-containing protein 1,
• Gene location: Xq22.3 (107820452: 107931636)     Exons: 11     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures i

Protein Summary

• Protein general information: Q9UJV3  
  • Name: Probable E3 ubiquitin protein ligase MID2 (EC 2.3.2.27) (Midin 2) (Midline defect 2) (Midline 2) (RING finger protein 60) (RING type E3 ubiquitin transferase MID2) (Tripartite motif containing protein 1)
  • Length: 735  
  • Mass: 83210
  • Tissue specificity: Low level in fetal kidney and lung, and in adult prostate, ovary and small intestine.
• Sequence:

  MGESPASVVLNASGGLFSLKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQ
  CPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPTTAMSSERIACQFCEQDPPRDA
  VKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHR
  DHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMI
  AVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINF
  NDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISK
  SWCSWGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSE
  PTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSS
  TWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLH
  LHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH

• Structural information:
  • Protein Domains: (340..39-)
    (/note="COS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00586-)
    (398..53-)
    (/note="Fibronectin-type-III)
    (516..70-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003649  IPR003879  IPR013320  IPR017903   IPR003961  IPR036116  IPR040859  IPR035752  IPR003877  IPR027370  IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS51262 PS50119 PS00518 PS50089
  • CDD: cd00021 cd00063 cd13739
  • PDB: 2DJA 2DMK
  • PDBsum: 2DJA 2DMK
  • STRING: ENSP00000262843
• Other Databases: GeneCards:  MID2  Malacards:  MID2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:1902187	negative regulation of viral release from host cell	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0032897	negative regulation of viral transcription	IDA	biological process
GO:0005874	microtubule	IDA	cellular component
GO:0005874	microtubule	IDA	colocalizes with
GO:0051091	positive regulation of DNA-binding transcription factor activity	IMP	biological process
GO:0051219	phosphoprotein binding	IPI	molecular function
GO:0008017	microtubule binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0035372	protein localization to microtubule	IMP	biological process

Diseases

Associated diseases	References
X-linked mental retardation	KEGG:H00480
X-linked mental retardation	KEGG:H00480
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881