• Gene id: 11040

Gene Summary

• Gene Symbol: PIM2   Gene   UCSC   Ensembl
• Gene name: Pim-2 proto-oncogene, serine/threonine kinase
• Alternate names: serine/threonine-protein kinase pim-2, pim-2 oncogene, pim-2h, proto-oncogene Pim-2 (serine threonine kinase),
• Gene location: Xp11.23 (48919023: 48913181)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]
• OMIM: 142210

Protein Summary

• Protein general information: Q9P1W9  
  • Name: Serine/threonine protein kinase pim 2 (EC 2.7.11.1) (Pim 2h)
  • Length: 311  
  • Mass: 34190
  • Tissue specificity: Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tiss
• Sequence:

  MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLS
  DSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAA
  IQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLG
  ILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
  GPAPLAWSLLP

• Structural information:
  • Protein Domains: (32..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR017348  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 2IWI 4X7Q
  • PDBsum: 2IWI 4X7Q
  • STRING: ENSP00000365692
• Other Databases: GeneCards:  PIM2  Malacards:  PIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0050821	protein stabilization	IMP	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0010508	positive regulation of autophagy	ISS	biological process
GO:0006468	protein phosphorylation	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0016239	positive regulation of macroautophagy	IEA	biological process
GO:0008637	apoptotic mitochondrial changes	IEA	biological process
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0009615	response to virus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05221	Acute myeloid leukemia

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881