• Gene id: 1104

Gene Summary

• Gene Symbol: RCC1   Gene   UCSC   Ensembl
• Aliases: CHC1, RCC1-I, SNHG3-RCC1
• Gene name: regulator of chromosome condensation 1
• Alternate names: regulator of chromosome condensation, SNHG3-RCC1 readthrough, cell cycle regulatory protein, guanine nucleotide-releasing protein,
• Gene location: 1p35.3 (28505942: 28539299)     Exons: 15     NC_000001.11
• OMIM: 603441

Protein Summary

• Protein general information: P18754  
  • Name: Regulator of chromosome condensation (Cell cycle regulatory protein) (Chromosome condensation protein 1)
  • Length: 421  
  • Mass: 44969
• Sequence:

  MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAG
  GMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNN
  GVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLV
  PKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFS
  GGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNY
  QLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS

• Structural information:
  • Interpro: IPR009091  IPR000408  
  • Prosite: PS00625 PS00626 PS50012
  • PDB: 1A12 1I2M 5E1B 5E1D 5E1M 5E1O 5E2A 5E2B 5TBK 6DUB
  • PDBsum: 1A12 1I2M 5E1B 5E1D 5E1M 5E1O 5E2A 5E2B 5TBK 6DUB
  • DIP: 35416
  • STRING: ENSP00000362937
• Other Databases: GeneCards:  RCC1  Malacards:  RCC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0031291	Ran protein signal transduction	IBA	biological process
GO:1901673	regulation of mitotic spindle assembly	IBA	biological process
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051225	spindle assembly	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0016032	viral process	TAS	biological process
GO:0005087	Ran guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IMP	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0031491	nucleosome binding	IMP	molecular function
GO:0043199	sulfate binding	IDA	molecular function
GO:0008536	Ran GTPase binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0007052	mitotic spindle organization	IDA	biological process
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0000785	chromatin	IDA	cellular component
GO:0007088	regulation of mitotic nuclear division	IDA	biological process
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0031291	Ran protein signal transduction	IBA	biological process
GO:1901673	regulation of mitotic spindle assembly	IBA	biological process
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051225	spindle assembly	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0016032	viral process	TAS	biological process
GO:0005087	Ran guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IMP	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0031491	nucleosome binding	IMP	molecular function
GO:0043199	sulfate binding	IDA	molecular function
GO:0008536	Ran GTPase binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0007052	mitotic spindle organization	IDA	biological process
GO:0005087	Ran guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0000785	chromatin	IDA	cellular component
GO:0007088	regulation of mitotic nuclear division	IDA	biological process
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881