• Gene id: 11035

Gene Summary

• Gene Symbol: RIPK3   Gene   UCSC   Ensembl
• Aliases: RIP3
• Gene name: receptor interacting serine/threonine kinase 3
• Alternate names: receptor-interacting serine/threonine-protein kinase 3, RIP-3, RIP-like protein kinase 3, receptor interacting protein 3,
• Gene location: 14q12 (24339990: 24336024)     Exons: 10     NC_000014.9
• Gene summary(Entrez): The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytopla
• OMIM: 300317

Protein Summary

• Protein general information: Q9Y572  
  • Name: Receptor interacting serine/threonine protein kinase 3 (EC 2.7.11.1) (RIP like protein kinase 3) (Receptor interacting protein 3) (RIP 3)
  • Length: 518  
  • Mass: 56887
  • Tissue specificity: Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers. {ECO
• Sequence:

  MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRL
  EGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLHRDLKPSNVLL
  DPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTE
  PSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
  VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQ
  EEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLV
  NIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK

• Structural information:
  • Protein Domains: (21..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR025735  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 5V7Z
  • PDBsum: 5V7Z
  • DIP: 27519
  • STRING: ENSP00000216274
• Other Databases: GeneCards:  RIPK3  Malacards:  RIPK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070301	cellular response to hydrogen peroxide	ISS	biological process
GO:0097300	programmed necrotic cell death	ISS	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004672	protein kinase activity	IBA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0070266	necroptotic process	IMP	biological process
GO:0097528	execution phase of necroptosis	ISS	biological process
GO:0051607	defense response to virus	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	ISS	cellular component
GO:0042981	regulation of apoptotic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0012501	programmed cell death	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070266	necroptotic process	TAS	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IEA	biological process
GO:0070266	necroptotic process	IEA	biological process
GO:0070235	regulation of activation-induced cell death of T cells	IEA	biological process
GO:0051351	positive regulation of ligase activity	IEA	biological process
GO:0048538	thymus development	IEA	biological process
GO:0046006	regulation of activated T cell proliferation	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0032649	regulation of interferon-gamma production	IEA	biological process
GO:0010940	positive regulation of necrotic cell death	IEA	biological process
GO:0002819	regulation of adaptive immune response	IEA	biological process
GO:2000452	regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	IEA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IEA	biological process
GO:2000377	regulation of reactive oxygen species metabolic process	IEA	biological process
GO:0097300	programmed necrotic cell death	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0060545	positive regulation of necroptotic process	IEA	biological process
GO:0051353	positive regulation of oxidoreductase activity	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048535	lymph node development	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0004704	NF-kappaB-inducing kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0001914	regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0038061	NIK/NF-kappaB signaling	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0060545	positive regulation of necroptotic process	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0048538	thymus development	ISS	biological process
GO:0043029	T cell homeostasis	ISS	biological process
GO:0097527	necroptotic signaling pathway	IMP	biological process
GO:0060545	positive regulation of necroptotic process	IMP	biological process
GO:0033077	T cell differentiation in thymus	ISS	biological process
GO:0032147	activation of protein kinase activity	IMP	biological process
GO:0004672	protein kinase activity	IMP	molecular function
GO:0001914	regulation of T cell mediated cytotoxicity	ISS	biological process
GO:1990000	amyloid fibril formation	IMP	biological process
GO:0070266	necroptotic process	IMP	biological process
GO:0070235	regulation of activation-induced cell death of T cells	ISS	biological process
GO:0046006	regulation of activated T cell proliferation	ISS	biological process
GO:0032649	regulation of interferon-gamma production	ISS	biological process
GO:0010922	positive regulation of phosphatase activity	IMP	biological process
GO:0002819	regulation of adaptive immune response	ISS	biological process
GO:2000452	regulation of CD8-positive, alpha-beta cytotoxic T cell extravasation	ISS	biological process
GO:0048536	spleen development	ISS	biological process
GO:0048535	lymph node development	ISS	biological process
GO:0044877	protein-containing complex binding	IMP	molecular function
GO:0004672	protein kinase activity	IMP	molecular function
GO:0097527	necroptotic signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04621	NOD-like receptor signaling pathway
hsa04217	Necroptosis
hsa04668	TNF signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881