• Gene id: 11034

Gene Summary

• Gene Symbol: DSTN   Gene   UCSC   Ensembl
• Aliases: ACTDP, ADF, HEL32, bA462D18.2
• Gene name: destrin, actin depolymerizing factor
• Alternate names: destrin, actin-depolymerizing factor, bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP)), epididymis luminal protein 32, epididymis secretory sperm binding protein,
• Gene location: 20p12.1 (17569172: 17609918)     Exons: 6     NC_000020.11
• Gene summary(Entrez): The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) an
• OMIM: 609114

Protein Summary

• Protein general information: P60981  
  • Name: Destrin (Actin depolymerizing factor) (ADF)
  • Length: 165  
  • Mass: 18506
  • Tissue specificity: Widely distributed in various tissues.
• Sequence:

  MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGML
  PEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAE
  KLGGSLIVAFEGCPV

• Structural information:
  • Protein Domains: (4..15-)
    (/note="ADF-H-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00599"-)
  • Interpro: IPR002108  IPR029006  IPR017904  IPR029924  
  • Prosite: PS51263
  • CDD: cd11286
  • STRING: ENSP00000246069
• Other Databases: GeneCards:  DSTN  Malacards:  DSTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0048870	cell motility	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0030864	cortical actin cytoskeleton	IBA	cellular component
GO:0030043	actin filament fragmentation	IBA	biological process
GO:0030042	actin filament depolymerization	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0051015	actin filament binding	IDA	molecular function
GO:0051015	actin filament binding	IDA	molecular function
GO:0030042	actin filament depolymerization	IDA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030042	actin filament depolymerization	IEA	biological process
GO:0030836	positive regulation of actin filament depolymerization	IEA	biological process
GO:0051014	actin filament severing	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0051014	actin filament severing	TAS	biological process
GO:0008154	actin polymerization or depolymerization	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0030836	positive regulation of actin filament depolymerization	IEA	biological process
GO:0030043	actin filament fragmentation	IEA	biological process
GO:0030042	actin filament depolymerization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray