• Gene id: 11027

Gene Summary

• Gene Symbol: LILRA2   Gene   UCSC   Ensembl
• Aliases: CD85H, ILT1, LIR-7, LIR7
• Gene name: leukocyte immunoglobulin like receptor A2
• Alternate names: leukocyte immunoglobulin-like receptor subfamily A member 2, CD85 antigen-like family member H, immunoglobulin-like transcript 1, leucocyte Ig-like receptor A2, leukocyte immunoglobulin-like receptor 7, leukocyte immunoglobulin-like receptor subfamily A member,
• Gene location: 19q13.42 (54572987: 54590286)     Exons: 10     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cel
• OMIM: 604812

Protein Summary

• Protein general information: Q8N149  
  • Name: Leukocyte immunoglobulin like receptor subfamily A member 2 (CD85 antigen like family member H) (Immunoglobulin like transcript 1) (ILT 1) (Leukocyte immunoglobulin like receptor 7) (LIR 7) (CD antigen CD85h)
  • Length: 483  
  • Mass: 52992
  • Tissue specificity: Detected on the surface of all peripheral blood monocytes, neutrophils, basophils and eosinophils (at protein level) (PubMed
• Sequence:

  MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQE
  PGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFD
  GFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPS
  LSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHN
  LSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQ
  NQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVENL
  IRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR

• Structural information:
  • Protein Domains: (27..11-)
    1 (/note="Ig-like-C2-type)
    (117..22-)
    2 (/note="Ig-like-C2-type)
    (224..31-)
    3 (/note="Ig-like-C2-type)
    (324..41-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR016332  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013151  
  • Prosite: PS50835
  • PDB: 2OTP
  • PDBsum: 2OTP
  • STRING: ENSP00000251377
• Other Databases: GeneCards:  LILRA2  Malacards:  LILRA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002220	innate immune response activating cell surface receptor signaling pathway	IDA	biological process
GO:0002283	neutrophil activation involved in immune response	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0001791	IgM binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0031665	negative regulation of lipopolysaccharide-mediated signaling pathway	IMP	biological process
GO:0032635	interleukin-6 production	IMP	biological process
GO:0032604	granulocyte macrophage colony-stimulating factor production	IMP	biological process
GO:0071611	granulocyte colony-stimulating factor production	IMP	biological process
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0032637	interleukin-8 production	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003823	antigen binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006952	defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:2000778	positive regulation of interleukin-6 secretion	IDA	biological process
GO:1904469	positive regulation of tumor necrosis factor secretion	IDA	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	IDA	biological process
GO:0050867	positive regulation of cell activation	IDA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881