• Gene id: 11026

Gene Summary

• Gene Symbol: LILRA3   Gene   UCSC   Ensembl
• Aliases: CD85E, HM31, HM43, ILT-6, ILT6, LIR-4, LIR4
• Gene name: leukocyte immunoglobulin like receptor A3
• Alternate names: leukocyte immunoglobulin-like receptor subfamily A member 3, CD85 antigen-like family member E, immunoglobulin-like transcript 6, leucocyte Ig-like receptor A3, leukocyte immunoglobulin-like receptor 4, leukocyte immunoglobulin-like receptor, subfamily A (with,
• Gene location: 19q13.4 (: )     Exons:     
• Gene summary(Entrez): This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members
• OMIM: 608256

Protein Summary

• Protein general information: Q8N6C8  
  • Name: Leukocyte immunoglobulin like receptor subfamily A member 3 (CD85 antigen like family member E) (Immunoglobulin like transcript 6) (ILT 6) (Leukocyte immunoglobulin like receptor 4) (LIR 4) (Monocyte inhibitory receptor HM43/HM31) (CD antigen CD85e)
  • Length: 439  
  • Mass: 47472
  • Tissue specificity: Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung. {ECO
• Sequence:

  MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQ
  ELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVA
  FDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKK
  PSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
  YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQS
  HKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

• Structural information:
  • Protein Domains: (27..10-)
    1 (/note="Ig-like-C2-type)
    (119..22-)
    2 (/note="Ig-like-C2-type)
    (226..31-)
    3 (/note="Ig-like-C2-type)
    (326..41-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR016332  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  
  • Prosite: PS50835
  • PDB: 3Q2C
  • PDBsum: 3Q2C
• Other Databases: GeneCards:  LILRA3  Malacards:  LILRA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0003823	antigen binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881