• Gene id: 11024

Gene Summary

• Gene Symbol: LILRA1   Gene   UCSC   Ensembl
• Aliases: CD85I, LIR-6, LIR6
• Gene name: leukocyte immunoglobulin like receptor A1
• Alternate names: leukocyte immunoglobulin-like receptor subfamily A member 1, CD85 antigen-like family member I, leucocyte Ig-like receptor A1, leukocyte immunoglobulin-like receptor 6, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 1,
• Gene location: 19q13.42 (54593575: 54602380)     Exons: 10     NC_000019.10
• Gene summary(Entrez): This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompati
• OMIM: 609111

Protein Summary

• Protein general information: O75019  
  • Name: Leukocyte immunoglobulin like receptor subfamily A member 1 (CD85 antigen like family member I) (Leukocyte immunoglobulin like receptor 6) (LIR 6) (CD antigen CD85i)
  • Length: 489  
  • Mass: 53275
  • Tissue specificity: Detected in monocytes and B-cells. {ECO
• Sequence:

  MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQ
  EIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVA
  FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKK
  PSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGA
  YNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEY
  PKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKT
  ASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSL

• Structural information:
  • Protein Domains: (27..11-)
    1 (/note="Ig-like-C2-type)
    (119..22-)
    2 (/note="Ig-like-C2-type)
    (226..31-)
    3 (/note="Ig-like-C2-type)
    (326..41-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR016332  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  
  • Prosite: PS50835
  • STRING: ENSP00000251372
• Other Databases: GeneCards:  LILRA1  Malacards:  LILRA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0003823	antigen binding	TAS	molecular function
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881