• Gene id: 11021

Gene Summary

• Gene Symbol: RAB35   Gene   UCSC   Ensembl
• Aliases: H-ray, RAB1C, RAY
• Gene name: RAB35, member RAS oncogene family
• Alternate names: ras-related protein Rab-35, GTP-binding protein RAY, ras-related protein rab-1c (GTP-binding protein ray),
• Gene location: 12q24.23 (213051232: 213378752)     Exons: 22     NC_000001.11
• OMIM: 604199

Protein Summary

• Protein general information: Q15286  
  • Name: Ras related protein Rab 35 (GTP binding protein RAY) (Ras related protein Rab 1C)
  • Length: 201  
  • Mass: 23025
• Sequence:

  MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITS
  TYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETS
  AKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

• Structural information:
  • Interpro: IPR027417  IPR041815  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04110
  • PDB: 3TW8 6EKK 6IF2 6IF3
  • PDBsum: 3TW8 6EKK 6IF2 6IF3
  • STRING: ENSP00000229340
• Other Databases: GeneCards:  RAB35  Malacards:  RAB35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0032456	endocytic recycling	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0010008	endosome membrane	IBA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:1990090	cellular response to nerve growth factor stimulus	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0036010	protein localization to endosome	IMP	biological process
GO:0016197	endosomal transport	IMP	biological process
GO:0010008	endosome membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0036010	protein localization to endosome	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0045334	clathrin-coated endocytic vesicle	IDA	cellular component
GO:0031253	cell projection membrane	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048227	plasma membrane to endosome transport	IMP	biological process
GO:0008104	protein localization	IMP	biological process
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019882	antigen processing and presentation	IMP	biological process
GO:0016197	endosomal transport	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray