• Gene id: 11018

Gene Summary

• Gene Symbol: TMED1   Gene   UCSC   Ensembl
• Aliases: IL1RL1LG, Il1rl1l, Tp24, p24g1
• Gene name: transmembrane p24 trafficking protein 1
• Alternate names: transmembrane emp24 domain-containing protein 1, IL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, p24 family protein gamma-1, putative T1/ST2 receptor-binding protein, transmembrane emp24 protein transport domain containing 1,
• Gene location: 19p13.2 (10836211: 10832066)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene belongs to the TMED (transmembrane emp24 domain-containing) protein family, which is involved in the vesicular trafficking of proteins. The protein encoded by this gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1
• OMIM: 616356

Protein Summary

• Protein general information: Q13445  
  • Name: Transmembrane emp24 domain containing protein 1 (Interleukin 1 receptor like 1 ligand) (Putative T1/ST2 receptor binding protein) (p24 family protein gamma 1) (Tp24) (p24gamma1)
  • Length: 227  
  • Mass: 25206
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MMAAGAALALALWLLMPPVEVGGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLE
  SPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEMLDVK
  MEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQVCTLKRFFQDKRPV
  PT

• Structural information:
  • Protein Domains: (43..12-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR009038  IPR036598  IPR015720  
  • Prosite: PS50866
  • STRING: ENSP00000214869
• Other Databases: GeneCards:  TMED1  Malacards:  TMED1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray