• Gene id: 11015

Gene Summary

• Gene Symbol: KDELR3   Gene   UCSC   Ensembl
• Aliases: ERD2L3
• Gene name: KDEL endoplasmic reticulum protein retention receptor 3
• Alternate names: ER lumen protein-retaining receptor 3, KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3, KDEL receptor 3,
• Gene location: 22q13.1 (38468061: 38483446)     Exons: 5     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the KDEL endoplasmic reticulum protein retention receptor family. Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval f

Protein Summary

• Protein general information: O43731  
  • Name: ER lumen protein retaining receptor 3 (KDEL endoplasmic reticulum protein retention receptor 3) (KDEL receptor 3)
  • Length: 214  
  • Mass: 25027
• Sequence:

  MNVFRILGDLSHLLAMILLLGKIWRSKCCKGISGKSQILFALVFTTRYLDLFTNFISIYNTVMKVVFLLCAYVTV
  YMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILWTFSIYLESVAILPQLFMISKTGEAETITTH
  YLFFLGLYRALYLANWIRRYQTENFYDQIAVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPMPI

• Structural information:
  • Interpro: IPR000133  
  • Prosite: PS00951 PS00952
  • STRING: ENSP00000386918
• Other Databases: GeneCards:  KDELR3  Malacards:  KDELR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006621	protein retention in ER lumen	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005801	cis-Golgi network	IBA	cellular component
GO:0046923	ER retention sequence binding	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005046	KDEL sequence binding	IDA	molecular function
GO:0030663	COPI-coated vesicle membrane	IDA	colocalizes with
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IDA	biological process
GO:0046923	ER retention sequence binding	IEA	molecular function
GO:0006621	protein retention in ER lumen	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030663	COPI-coated vesicle membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05110	Vibrio cholerae infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq