• Gene id: 11011

Gene Summary

• Gene Symbol: TLK2   Gene   UCSC   Ensembl
• Aliases: HsHPK, MRD57, PKU-ALPHA
• Gene name: tousled like kinase 2
• Alternate names: serine/threonine-protein kinase tousled-like 2,
• Gene location: 17q23.2 (62470907: 62615480)     Exons: 31     NC_000017.11
• Gene summary(Entrez): This gene encodes a nuclear serine/threonine kinase that was first identified in Arabidopsis. The encoded protein is thought to function in the regulation of chromatin assembly in the S phase of the cell cycle by regulating the levels of a histone H3/H4 c
• OMIM: 608439

Protein Summary

• Protein general information: Q86UE8  
  • Name: Serine/threonine protein kinase tousled like 2 (EC 2.7.11.1) (HsHPK) (PKU alpha) (Tousled like kinase 2)
  • Length: 772  
  • Mass: 87661
  • Tissue specificity: Ubiquitous. Detected in placenta, fetal liver, kidney, pancreas, heart and skeletal muscle. Highly expressed in testis. Detected in spleen, thymus, colon, ovary, small intestine, prostate and peripheral blood leukocytes. {ECO
• Sequence:

  MMEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQG
  KGTPRGHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPRRVEQPLYGLDGSAAKEATEEQSALPTLM
  SVMLAKPRLDTEQLAQRGAGLCFTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKN
  SDLEKKEGRIDDLLRANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRLGHFT
  TVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPATNEQKQRKSKTNGAENETP
  SSGNTELKDTAPALGAHSLLRLTLAEYHEQEEIFKLRLGHLKKEEAEIQAELERLERVRNLHIRELKRIHNEDNS
  QFKDHPTLNDRYLLLHLLGRGGFSEVYKAFDLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKELDHPR
  IVKLYDYFSLDTDSFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNILL
  VNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQGAGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFYQCL
  YGRKPFGHNQSQQDILQENTILKATEVQFPPKPVVTPEAKAFIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSVS
  TSSPAGAAIASTSGASNNSSSN

• Structural information:
  • Protein Domains: (462..74-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  IPR027086  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 5O0Y
  • PDBsum: 5O0Y
  • STRING: ENSP00000316512
• Other Databases: GeneCards:  TLK2  Malacards:  TLK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001672	regulation of chromatin assembly or disassembly	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0071480	cellular response to gamma radiation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005882	intermediate filament	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010507	negative regulation of autophagy	NAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0001672	regulation of chromatin assembly or disassembly	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881