• Gene id: 11010

Gene Summary

• Gene Symbol: GLIPR1   Gene   UCSC   Ensembl
• Aliases: CRISP7, GLIPR, RTVP1
• Gene name: GLI pathogenesis related 1
• Alternate names: glioma pathogenesis-related protein 1, GLI pathogenesis-related 1 (glioma), gliPR 1, protein RTVP-1, related to testis-specific, vespid, and pathogenesis proteins 1, testes-specific vespid and pathogenesis protein 1,
• Gene location: 12q21.2 (166342544: 166319727)     Exons: 9     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage a
• OMIM: 602692

Protein Summary

• Protein general information: P48060  
  • Name: Glioma pathogenesis related protein 1 (GliPR 1) (Protein RTVP 1)
  • Length: 266  
  • Mass: 30366
  • Tissue specificity: According to PubMed
• Sequence:

  MRVTLATIAWMVSFVSNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNC
  QFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVG
  CAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGW
  PIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPNLVLLD

• Structural information:
  • Protein Domains: (38..17-)
    (/note="SCP"-)
  • Interpro: IPR018244  IPR014044  IPR035940  IPR001283  IPR002413  
  • Prosite: PS01009 PS01010
  • PDB: 3Q2R 3Q2U
  • PDBsum: 3Q2R 3Q2U
  • STRING: ENSP00000266659
• Other Databases: GeneCards:  GLIPR1  Malacards:  GLIPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0019216	regulation of lipid metabolic process	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R