• Gene id: 11009

Gene Summary

• Gene Symbol: IL24   Gene   UCSC   Ensembl
• Aliases: C49A, FISP, IL10B, MDA7, MOB5, ST16
• Gene name: interleukin 24
• Alternate names: interleukin-24, IL-4-induced secreted protein, melanocyte-associated Mda-7, melanoma differentiation-associated gene 7 protein, suppression of tumorigenicity 16 (melanoma differentiation),
• Gene location: 1q32.1 (206897403: 206904138)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of
• OMIM: 194542

Protein Summary

• Protein general information: Q13007  
  • Name: Interleukin 24 (IL 24) (Melanoma differentiation associated gene 7 protein) (MDA 7) (Suppression of tumorigenicity 16 protein)
  • Length: 206  
  • Mass: 23825
  • Tissue specificity: Up-regulated in melanoma cells induced to terminally differentiate.
• Sequence:

  MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWA
  VKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQ
  LQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

• Structural information:
  • Interpro: IPR009079  IPR020423  IPR020444  
  • Prosite: PS00520
  • PDB: 6DF3 6GG1
  • PDBsum: 6DF3 6GG1
  • STRING: ENSP00000375795
• Other Databases: GeneCards:  IL24  Malacards:  IL24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042501	serine phosphorylation of STAT protein	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IEA	biological process
GO:0071353	cellular response to interleukin-4	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881