• Gene id: 11006

Gene Summary

• Gene Symbol: LILRB4   Gene   UCSC   Ensembl
• Aliases: CD85K, ILT-3, ILT3, LIR-5, LIR5
• Gene name: leukocyte immunoglobulin like receptor B4
• Alternate names: leukocyte immunoglobulin-like receptor subfamily B member 4, CD85 antigen-like family member K, immunoglobulin-like transcript 3, leucocyte Ig-like receptor B4, leukocyte immunoglobulin-like receptor 5, leukocyte immunoglobulin-like receptor, subfamily B (with,
• Gene location: 19q13.42 (54662523: 54670358)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular
• OMIM: 118490

Protein Summary

• Protein general information: Q8NHJ6  
  • Name: Leukocyte immunoglobulin like receptor subfamily B member 4 (CD85 antigen like family member K) (Immunoglobulin like transcript 3) (ILT 3) (Leukocyte immunoglobulin like receptor 5) (LIR 5) (Monocyte inhibitory receptor HM18) (CD antigen CD85k)
  • Length: 448  
  • Mass: 49356
  • Tissue specificity: Detected in monocytes, macrophages, dendritic cells, lung, natural killer cells and B-cells. {ECO
• Sequence:

  MIPTFTALLCLGLSLGPRTHMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWDRQNPL
  EPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPM
  DTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEDPR
  PSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR
  PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASP
  PSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH

• Structural information:
  • Protein Domains: (27..11-)
    1 (/note="Ig-like-C2-type)
    (124..21-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013151  
  • Prosite: PS50835
  • PDB: 3P2T 6K7O
  • PDBsum: 3P2T 6K7O
  • STRING: ENSP00000375616
• Other Databases: GeneCards:  LILRB4  Malacards:  LILRB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003823	antigen binding	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1902894	negative regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:1900181	negative regulation of protein localization to nucleus	IDA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray