• Gene id: 11001

Gene Summary

• Gene Symbol: SLC27A2   Gene   UCSC   Ensembl
• Aliases: ACSVL1, FACVL1, FATP2, HsT17226, VLACS, VLCS, hFACVL1
• Gene name: solute carrier family 27 member 2
• Alternate names: very long-chain acyl-CoA synthetase, FATP-2, THCA-CoA ligase, arachidonate--CoA ligase, fatty acid transport protein 2, fatty-acid-coenzyme A ligase, very long-chain 1, long-chain-fatty-acid--CoA ligase, phytanate--CoA ligase, solute carrier family 27 (fatty acid,
• Gene location: 15q21.2 (50182195: 50236391)     Exons: 10     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty aci

Protein Summary

• Protein general information: O14975  
  • Name: Very long chain acyl CoA synthetase (VLACS) (VLCS) (EC 6.2.1. ) (Arachidonate CoA ligase) (EC 6.2.1.15) (Fatty acid transport protein 2) (FATP 2) (Fatty acid coenzyme A ligase, very long chain 1) (Long chain fatty acid CoA ligase) (EC 6.2.1.3) (Phytanat
  • Length: 620  
  • Mass: 70312
  • Tissue specificity: Expressed in liver, kidney, placenta and pancreas. {ECO
• Sequence:

  MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKPFLLFR
  DETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRAKSLLHCFQCC
  GAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYT
  SGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
  CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYA
  RKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKL
  RDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIG
  MASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
  MYVPMTEDIYNAISAKTLKL

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  IPR030305  
  • Prosite: PS00455
  • STRING: ENSP00000267842
• Other Databases: GeneCards:  SLC27A2  Malacards:  SLC27A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0005779	integral component of peroxisomal membrane	IBA	cellular component
GO:0015245	fatty acid transmembrane transporter activity	IBA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0070251	pristanate-CoA ligase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0006699	bile acid biosynthetic process	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0042760	very long-chain fatty acid catabolic process	IBA	biological process
GO:0044539	long-chain fatty acid import into cell	IBA	biological process
GO:0050197	phytanate-CoA ligase activity	IBA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0015908	fatty acid transport	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0102391	decanoate-CoA ligase activity	IEA	molecular function
GO:0047747	cholate-CoA ligase activity	IEA	molecular function
GO:0003996	acyl-CoA ligase activity	IEA	molecular function
GO:0050197	phytanate-CoA ligase activity	IEA	molecular function
GO:0001561	fatty acid alpha-oxidation	TAS	biological process
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070251	pristanate-CoA ligase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0050197	phytanate-CoA ligase activity	TAS	molecular function
GO:0042760	very long-chain fatty acid catabolic process	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0000038	very long-chain fatty acid metabolic process	IEA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0070251	pristanate-CoA ligase activity	IDA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0097089	methyl-branched fatty acid metabolic process	IDA	biological process
GO:0050197	phytanate-CoA ligase activity	IDA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0006699	bile acid biosynthetic process	IDA	biological process
GO:0006635	fatty acid beta-oxidation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0001561	fatty acid alpha-oxidation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0005779	integral component of peroxisomal membrane	IBA	cellular component
GO:0015245	fatty acid transmembrane transporter activity	IBA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0070251	pristanate-CoA ligase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005788	endoplasmic reticulum lumen	IBA	cellular component
GO:0006699	bile acid biosynthetic process	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0042760	very long-chain fatty acid catabolic process	IBA	biological process
GO:0044539	long-chain fatty acid import into cell	IBA	biological process
GO:0050197	phytanate-CoA ligase activity	IBA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0015908	fatty acid transport	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0102391	decanoate-CoA ligase activity	IEA	molecular function
GO:0047747	cholate-CoA ligase activity	IEA	molecular function
GO:0003996	acyl-CoA ligase activity	IEA	molecular function
GO:0050197	phytanate-CoA ligase activity	IEA	molecular function
GO:0001561	fatty acid alpha-oxidation	TAS	biological process
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005778	peroxisomal membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070251	pristanate-CoA ligase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0050197	phytanate-CoA ligase activity	TAS	molecular function
GO:0042760	very long-chain fatty acid catabolic process	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0000038	very long-chain fatty acid metabolic process	IEA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0070251	pristanate-CoA ligase activity	IDA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005779	integral component of peroxisomal membrane	IDA	cellular component
GO:0097089	methyl-branched fatty acid metabolic process	IDA	biological process
GO:0050197	phytanate-CoA ligase activity	IDA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:0006699	bile acid biosynthetic process	IDA	biological process
GO:0006635	fatty acid beta-oxidation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005788	endoplasmic reticulum lumen	IDA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0001561	fatty acid alpha-oxidation	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance
hsa04146	Peroxisome
hsa03320	PPAR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881