• Gene id: 10999

Gene Summary

• Gene Symbol: SLC27A4   Gene   UCSC   Ensembl
• Aliases: ACSVL4, FATP4, IPS
• Gene name: solute carrier family 27 member 4
• Alternate names: long-chain fatty acid transport protein 4, arachidonate--CoA ligase, long-chain-fatty-acid--CoA ligase, solute carrier family 27 (fatty acid transporter), member 4, very long-chain acyl-CoA synthetase 4,
• Gene location: 9q34.11 (128340515: 128361469)     Exons: 14     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the smal
• OMIM: 604821

Protein Summary

• Protein general information: Q6P1M0  
  • Name: Long chain fatty acid transport protein 4 (FATP 4) (Fatty acid transport protein 4) (Arachidonate CoA ligase) (EC 6.2.1.15) (Long chain fatty acid CoA ligase) (Solute carrier family 27 member 4) (Very long chain acyl CoA synthetase 4) (ACSVL4) (EC 6.2.1
  • Length: 643  
  • Mass: 72064
  • Tissue specificity: Expressed at highest levels in brain, testis, colon and kidney. Expressed at medium levels in heart and liver, small intestine and stomach. Expressed at low levels in peripheral leukocytes, bone marrow, skeletal muscle and aorta. Expre
• Sequence:

  MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLQERRT
  VPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLG
  VEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGAVPPSTEHLDPLLKDA
  PKHLPSCPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ
  CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRF
  HIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGEPGQLVGR
  IIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTL
  SRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE
  LRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  IPR030304   IPR022272  
  • Prosite: PS00455
  • STRING: ENSP00000300456
• Other Databases: GeneCards:  SLC27A4  Malacards:  SLC27A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005324	long-chain fatty acid transporter activity	IMP	molecular function
GO:1990379	lipid transport across blood-brain barrier	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015909	long-chain fatty acid transport	IMP	biological process
GO:0044539	long-chain fatty acid import into cell	IBA	biological process
GO:0042760	very long-chain fatty acid catabolic process	IBA	biological process
GO:0007584	response to nutrient	IBA	biological process
GO:0005902	microvillus	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0001579	medium-chain fatty acid transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0015908	fatty acid transport	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0015909	long-chain fatty acid transport	TAS	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0000038	very long-chain fatty acid metabolic process	IEA	biological process
GO:0001579	medium-chain fatty acid transport	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0042760	very long-chain fatty acid catabolic process	IEA	biological process
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0015909	long-chain fatty acid transport	IEA	biological process
GO:0031526	brush border membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0043588	skin development	IEA	biological process
GO:0062003	negative regulation of all-trans-retinyl-ester hydrolase, 11-cis retinol forming activity	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0044539	long-chain fatty acid import into cell	IDA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance
hsa03320	PPAR signaling pathway
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Ichthyosis prematurity syndrome	KEGG:H00741
Ichthyosis prematurity syndrome	KEGG:H00741
obesity	PMID:15168018
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray