• Gene id: 10998

Gene Summary

• Gene Symbol: SLC27A5   Gene   UCSC   Ensembl
• Aliases: ACSB, ACSVL6, BACS, BAL, FACVL3, FATP-5, FATP5, VLACSR, VLCS-H2, VLCSH2
• Gene name: solute carrier family 27 member 5
• Alternate names: bile acyl-CoA synthetase, BA-CoA ligase, VLACS-related, bile acid-CoA ligase, cholate--CoA ligase, fatty acid transport protein 5, fatty-acid-Coenzyme A ligase, very long-chain 3, solute carrier family 27 (fatty acid transporter), member 5, very long-chain acyl-C,
• Gene location: 19q13.43 (58512064: 58498332)     Exons: 11     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not
• OMIM: 603314

Protein Summary

• Protein general information: Q9Y2P5  
  • Name: Bile acyl CoA synthetase (BACS) (EC 6.2.1.7) (Bile acid CoA ligase) (BA CoA ligase) (BAL) (Cholate CoA ligase) (Fatty acid transport protein 5) (FATP 5) (Fatty acid coenzyme A ligase, very long chain 3) (Solute carrier family 27 member 5) (Very long chai
  • Length: 690  
  • Mass: 75385
  • Tissue specificity: Predominantly expressed in liver. {ECO
• Sequence:

  MGVRQQLALLLLLLLLLWGLGQPVWPVAVALTLRWLLGDPTCCVLLGLAMLARPWLGPWVPHGLSLAAAALALTL
  LPARLPPGLRWLPADVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDA
  RACQAAWALKAELGDPASLCAGEPTALLVLASQAVPALCMWLGLAKLGCPTAWINPHGRGMPLAHSVLSSGARVL
  VVDPDLRESLEEILPKLQAENIRCFYLSHTSPTPGVGALGAALDAAPSHPVPADLRAGITWRSPALFIYTSGTTG
  LPKPAILTHERVLQMSKMLSLSGATADDVVYTVLPLYHVMGLVVGILGCLDLGATCVLAPKFSTSCFWDDCRQHG
  VTVILYVGELLRYLCNIPQQPEDRTHTVRLAMGNGLRADVWETFQQRFGPIRIWEVYGSTEGNMGLVNYVGRCGA
  LGKMSCLLRMLSPFELVQFDMEAAEPVRDNQGFCIPVGLGEPGLLLTKVVSQQPFVGYRGPRELSERKLVRNVRQ
  SGDVYYNTGDVLAMDREGFLYFRDRLGDTFRWKGENVSTHEVEGVLSQVDFLQQVNVYGVCVPGCEGKVGMAAVQ
  LAPGQTFDGEKLYQHVRAWLPAYATPHFIRIQDAMEVTSTFKLMKTRLVREGFNVGIVVDPLFVLDNRAQSFRPL
  TAEMYQAVCEGTWRL

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  IPR030302  
  • Prosite: PS00455
  • STRING: ENSP00000263093
• Other Databases: GeneCards:  SLC27A5  Malacards:  SLC27A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0006642	triglyceride mobilization	IBA	biological process
GO:0008206	bile acid metabolic process	IBA	biological process
GO:0015245	fatty acid transmembrane transporter activity	IBA	molecular function
GO:0000038	very long-chain fatty acid metabolic process	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006699	bile acid biosynthetic process	IBA	biological process
GO:0015911	long-chain fatty acid import across plasma membrane	IBA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0046951	ketone body biosynthetic process	IBA	biological process
GO:0047747	cholate-CoA ligase activity	IDA	molecular function
GO:0005324	long-chain fatty acid transporter activity	IDA	molecular function
GO:0006699	bile acid biosynthetic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0047747	cholate-CoA ligase activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0006699	bile acid biosynthetic process	TAS	biological process
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0047747	cholate-CoA ligase activity	IEA	molecular function
GO:0046951	ketone body biosynthetic process	IEA	biological process
GO:0015911	long-chain fatty acid import across plasma membrane	IEA	biological process
GO:0015908	fatty acid transport	IEA	biological process
GO:0047747	cholate-CoA ligase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0032991	protein-containing complex	IEA	cellular component
GO:0015245	fatty acid transmembrane transporter activity	IEA	molecular function
GO:0009925	basal plasma membrane	IEA	cellular component
GO:0008206	bile acid metabolic process	IEA	biological process
GO:0006642	triglyceride mobilization	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0008206	bile acid metabolic process	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0001676	long-chain fatty acid metabolic process	IEA	biological process
GO:0006699	bile acid biosynthetic process	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0000038	very long-chain fatty acid metabolic process	IDA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04931	Insulin resistance
hsa03320	PPAR signaling pathway
hsa04976	Bile secretion
hsa00120	Primary bile acid biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq