• Gene id: 10991

Gene Summary

• Gene Symbol: SLC38A3   Gene   UCSC   Ensembl
• Aliases: G17, NAT1, SN1, SNAT3
• Gene name: solute carrier family 38 member 3
• Alternate names: sodium-coupled neutral amino acid transporter 3, N-system amino acid transporter 1, Na(+)-coupled neutral amino acid transporter 3, system N amino acid transporter 1, system N1 Na+ and H+-coupled glutamine transporter,
• Gene location: 3p21.31 (50205267: 50221485)     Exons: 17     NC_000003.12
• OMIM: 601558

Protein Summary

• Protein general information: Q99624  
  • Name: Sodium coupled neutral amino acid transporter 3 (N system amino acid transporter 1) (Na(+) coupled neutral amino acid transporter 3) (Solute carrier family 38 member 3) (System N amino acid transporter 1)
  • Length: 504  
  • Mass: 55773
• Sequence:

  MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNL
  SNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKSSGVVGIRAYEQLGYRAFGTPGKLAAALAIT
  LQNIGAMSSYLYIIKSELPLVIQTFLNLEEKTSDWYMNGNYLVILVSVTIILPLALMRQLGYLGYSSGFSLSCMV
  FFLIAVIYKKFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQTAYTIPIMAFAFVCH
  PEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVESELLHTYSKVDPFDVLILCVRVAVLT
  AVTLTVPIVLFPVRRAIQQMLFPNQEFSWLRHVLIAVGLLTCINLLVIFAPNILGIFGVIGATSAPFLIFIFPAI
  FYFRIMPTEKEPARSTPKILALCFAMLGFLLMTMSLSFIIIDWASGTSRHGGNH

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000481301
• Other Databases: GeneCards:  SLC38A3  Malacards:  SLC38A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0005290	L-histidine transmembrane transporter activity	IBA	molecular function
GO:0006867	asparagine transport	IBA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IBA	molecular function
GO:0015817	histidine transport	IBA	biological process
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006868	glutamine transport	IBA	biological process
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0015182	L-asparagine transmembrane transporter activity	IBA	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0051365	cellular response to potassium ion starvation	IEA	biological process
GO:0015817	histidine transport	IEA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IEA	molecular function
GO:0005290	L-histidine transmembrane transporter activity	IEA	molecular function
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015817	histidine transport	IEA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IEA	molecular function
GO:0007565	female pregnancy	IEA	biological process
GO:0006867	asparagine transport	IEA	biological process
GO:0005290	L-histidine transmembrane transporter activity	IEA	molecular function
GO:0061402	positive regulation of transcription from RNA polymerase II promoter in response to acidic pH	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006868	glutamine transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:2000487	positive regulation of glutamine transport	IEA	biological process
GO:0015182	L-asparagine transmembrane transporter activity	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0006868	glutamine transport	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0089709	L-histidine transmembrane transport	IEA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IDA	molecular function
GO:0015182	L-asparagine transmembrane transporter activity	IDA	molecular function
GO:0015180	L-alanine transmembrane transporter activity	IDA	molecular function
GO:0006868	glutamine transport	IDA	biological process
GO:0015817	histidine transport	IDA	biological process
GO:0015808	L-alanine transport	IDA	biological process
GO:0006867	asparagine transport	IDA	biological process
GO:0005290	L-histidine transmembrane transporter activity	IDA	molecular function
GO:0005887	integral component of plasma membrane	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04724	Glutamatergic synapse
hsa04727	GABAergic synapse
hsa04964	Proximal tubule bicarbonate reclamation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq