• Gene id: 10990

Gene Summary

• Gene Symbol: LILRB5   Gene   UCSC   Ensembl
• Aliases: CD85C, LIR-8, LIR8
• Gene name: leukocyte immunoglobulin like receptor B5
• Alternate names: leukocyte immunoglobulin-like receptor subfamily B member 5, CD85 antigen-like family member C, leucocyte Ig-like receptor B5, leukocyte immunoglobulin-like receptor 8, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5,
• Gene location: 19q13.42 (54257291: 54249420)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular
• OMIM: 182128

Protein Summary

• Protein general information: O75023  
  • Name: Leukocyte immunoglobulin like receptor subfamily B member 5 (CD85 antigen like family member C) (Leukocyte immunoglobulin like receptor 8) (LIR 8) (CD antigen CD85c)
  • Length: 590  
  • Mass: 64126
  • Tissue specificity: Detected in a natural killer (NK) cells. {ECO
• Sequence:

  MTLTLSVLICLGLSVGPRTCVQAGTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPL
  EPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGL
  LTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPS
  LLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHN
  LSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYR
  HQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQ
  SGLGRHLGVVTGVSVAFVLLLFLLLFLLLRHRHQSKHRTSAHFYRPAGAAGPEPKDQGLQKRASPVADIQEEILN
  AAVKDTQPKDGVEMDARAAASEAPQDVTYAQLHSLTLRREATEPPPSQEREPPAEPSIYAPLAIH

• Structural information:
  • Protein Domains: (27..11-)
    1 (/note="Ig-like-C2-type)
    (111..22-)
    2 (/note="Ig-like-C2-type)
    (224..31-)
    3 (/note="Ig-like-C2-type)
    (337..41-)
    4" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013151  
  • Prosite: PS50835
  • STRING: ENSP00000406478
• Other Databases: GeneCards:  LILRB5  Malacards:  LILRB5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq