• Gene id: 10989

Gene Summary

• Gene Symbol: IMMT   Gene   UCSC   Ensembl
• Aliases: HMP, MICOS60, MINOS2, Mic60, P87, P87/89, P89, PIG4, PIG52
• Gene name: inner membrane mitochondrial protein
• Alternate names: MICOS complex subunit MIC60, cell proliferation-inducing gene 4/52 protein, cell proliferation-inducing protein 52, heart muscle protein, mitochondrial contact site and cristae organizing system subunit 60, mitochondrial inner membrane organizing system 2, mito,
• Gene location: 2 (86195769: 86143931)     Exons: 13     NC_000002.12
• OMIM: 600378

Protein Summary

• Protein general information: Q16891  
  • Name: MICOS complex subunit MIC60 (Cell proliferation inducing gene 4/52 protein) (Mitochondrial inner membrane protein) (Mitofilin) (p87/89)
  • Length: 758  
  • Mass: 83678
• Sequence:

  MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESV
  EKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIIS
  AAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLE
  DALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKE
  ELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDS
  ITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELAEQKATEKQHITLALEKQKLEEKRAFDSAVA
  KALEHHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFR
  RLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIK
  ANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPQQLK
  PPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGI
  GTTQVQPE

• Structural information:
  • Interpro: IPR019133  
  • DIP: 32517
  • STRING: ENSP00000387262
• Other Databases: GeneCards:  IMMT  Malacards:  IMMT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061617	MICOS complex	IBA	cellular component
GO:0070584	mitochondrion morphogenesis	IBA	biological process
GO:0042407	cristae formation	IBA	biological process
GO:0061617	MICOS complex	IDA	cellular component
GO:0061617	MICOS complex	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042407	cristae formation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051560	mitochondrial calcium ion homeostasis	IEA	biological process
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0007007	inner mitochondrial membrane organization	IC	biological process
GO:0005739	mitochondrion	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0061617	MICOS complex	HDA	cellular component
GO:0140275	MIB complex	HDA	cellular component
GO:0001401	SAM complex	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq