• Gene id: 10987

Gene Summary

• Gene Symbol: COPS5   Gene   UCSC   Ensembl
• Aliases: CSN5, JAB1, MOV-34, SGN5
• Gene name: COP9 signalosome subunit 5
• Alternate names: COP9 signalosome complex subunit 5, 38 kDa Mov34 homolog, COP9 constitutive photomorphogenic homolog subunit 5, jun activation domain-binding protein 1, signalosome subunit 5, testis secretory sperm-binding protein Li 231m,
• Gene location: 8q13.1 (67062132: 67043078)     Exons: 8     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha
• OMIM: 604850

Protein Summary

• Protein general information: Q92905  
  • Name: COP9 signalosome complex subunit 5 (SGN5) (Signalosome subunit 5) (EC 3.4. . ) (Jun activation domain binding protein 1)
  • Length: 334  
  • Mass: 37579
• Sequence:

  MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNL
  EVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGI
  DVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALE
  VSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL
  AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

• Structural information:
  • Protein Domains: (55..19-)
    (/note="MPN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01182"-)
  • Interpro: IPR037740  IPR040961  IPR000555  IPR037518  
  • Prosite: PS50249
  • PDB: 4D10 4D18 4F7O 4WSN 5JOG 5JOH 5M5Q 6R6H 6R7F 6R7H 6R7I
  • PDBsum: 4D10 4D18 4F7O 4WSN 5JOG 5JOH 5M5Q 6R6H 6R7F 6R7H 6R7I
  • DIP: 34546
  • STRING: ENSP00000350512
• Other Databases: GeneCards:  COPS5  Malacards:  COPS5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:1903894	regulation of IRE1-mediated unfolded protein response	IMP	biological process
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0000338	protein deneddylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008237	metallopeptidase activity	IBA	molecular function
GO:0019784	NEDD8-specific protease activity	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046328	regulation of JNK cascade	IDA	biological process
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0008021	synaptic vesicle	IDA	cellular component
GO:0000785	chromatin	IDA	colocalizes with
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000338	protein deneddylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008237	metallopeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000338	protein deneddylation	IMP	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0003743	translation initiation factor activity	TAS	molecular function
GO:0005852	eukaryotic translation initiation factor 3 complex	TAS	cellular component
GO:0006412	translation	TAS	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:1990182	exosomal secretion	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0019784	NEDD8-specific protease activity	TAS	molecular function
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0035718	macrophage migration inhibitory factor binding	IEA	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0019899	enzyme binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006413	translational initiation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray