• Gene id: 10983

Gene Summary

• Gene Symbol: CCNI   Gene   UCSC   Ensembl
• Aliases: CCNI1, CYC1, CYI
• Gene name: cyclin I
• Alternate names: cyclin-I, cyclin ITI,
• Gene location: 4q21.1 (77075988: 77047154)     Exons: 8     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
• OMIM: 618783

Protein Summary

• Protein general information: Q14094  
  • Name: Cyclin I
  • Length: 377  
  • Mass: 42557
  • Tissue specificity: Highest levels in adult heart, brain and skeletal muscle. Lower levels in adult placenta, lung, kidney and pancreas. Also high levels in fetal brain and lower levels in fetal lung, liver and kidney. Also abundant in testis and thyroid.
• Sequence:

  MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDR
  FLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDF
  LHIFHAIAVSTRPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLEMEKLIPDWLSLTIEL
  LQKAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLHPSSVPGPDFSKDNSKPEVPV
  RGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENVGSVCGTDLSRQEGHASPCPPLQPVS
  VM

• Structural information:
  • Interpro: IPR039361  IPR013763  IPR036915  IPR028856  IPR006671  
  • CDD: cd00043
  • STRING: ENSP00000237654
• Other Databases: GeneCards:  CCNI  Malacards:  CCNI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031965	nuclear membrane	IEA	cellular component
GO:0007283	spermatogenesis	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)