• Gene id: 10981

Gene Summary

• Gene Symbol: RAB32   Gene   UCSC   Ensembl
• Gene name: RAB32, member RAS oncogene family
• Alternate names: ras-related protein Rab-32,
• Gene location: 6q24.3 (146543832: 146554952)     Exons: 3     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene anchors the type II regulatory subunit of protein kinase A to the mitochondrion and aids in mitochondrial fission. The encoded protein also appears to be involved in autophagy and melanosome secretion. Variations in this g
• OMIM: 612906

Protein Summary

• Protein general information: Q13637  
  • Name: Ras related protein Rab 32
  • Length: 225  
  • Mass: 24997
  • Tissue specificity: Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung. {ECO
• Sequence:

  MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLV
  RLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKD
  SSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

• Structural information:
  • Interpro: IPR027417  IPR030697  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04107
  • PDB: 4CYM 4CZ2 5OEC 5OED 6FF8
  • PDBsum: 4CYM 4CZ2 5OEC 5OED 6FF8
  • DIP: 61889
  • STRING: ENSP00000356465
• Other Databases: GeneCards:  RAB32  Malacards:  RAB32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007005	mitochondrion organization	IMP	biological process
GO:0035612	AP-2 adaptor complex binding	IDA	NOT|molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0031905	early endosome lumen	IDA	NOT|cellular component
GO:0030742	GTP-dependent protein binding	IPI	molecular function
GO:0030742	GTP-dependent protein binding	IPI	molecular function
GO:0030742	GTP-dependent protein binding	IPI	molecular function
GO:0035651	AP-3 adaptor complex binding	IPI	molecular function
GO:0036461	BLOC-2 complex binding	IPI	molecular function
GO:0005525	GTP binding	NAS	molecular function
GO:1903232	melanosome assembly	IMP	biological process
GO:0035646	endosome to melanosome transport	IMP	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0042470	melanosome	IDA	cellular component
GO:0035650	AP-1 adaptor complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044233	mitochondria-associated endoplasmic reticulum membrane	IDA	cellular component
GO:0072657	protein localization to membrane	IMP	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0032438	melanosome organization	IBA	biological process
GO:0042470	melanosome	IBA	cellular component
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:1903232	melanosome assembly	IDA	biological process
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0033162	melanosome membrane	IDA	cellular component
GO:0090382	phagosome maturation	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0033162	melanosome membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033162	melanosome membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019882	antigen processing and presentation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881