• Gene id: 10980

Gene Summary

• Gene Symbol: COPS6   Gene   UCSC   Ensembl
• Aliases: CSN6, MOV34-34KD
• Gene name: COP9 signalosome subunit 6
• Alternate names: COP9 signalosome complex subunit 6, COP9 constitutive photomorphogenic homolog subunit 6, H_NH0506M12.12, JAB1-containing signalosome subunit 6, MOV34 homolog, 34 kD, SGN6, hVIP, vpr-interacting protein,
• Gene location: 7q22.1 (100088968: 100092186)     Exons: 10     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to tha
• OMIM: 614729

Protein Summary

• Protein general information: Q7L5N1  
  • Name: COP9 signalosome complex subunit 6 (SGN6) (Signalosome subunit 6) (JAB1 containing signalosome subunit 6) (MOV34 homolog) (Vpr interacting protein) (hVIP)
  • Length: 327  
  • Mass: 36163
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAAAAAAAAATNGTGGSSGMEVDAAVVPSVMACGVTGSVSVALHPLVILNISDHWIRMRSQEGRPVQVIGALIGK
  QEGRNIEVMNSFELLSHTVEEKIIIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPL
  FLKLNPMTKHTDLPVSVFESVIDIINGEATMLFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQH
  SAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCN
  TMNQFVNKFNVLYDRQGIGRRMRGLFF

• Structural information:
  • Protein Domains: (41..17-)
    (/note="MPN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01182"-)
  • Interpro: IPR000555  IPR037518  IPR033859  IPR024969  
  • Prosite: PS50249
  • CDD: cd08063
  • PDB: 4D10 4D18 4QFT 4R14 4WSN 6R6H 6R7F 6R7H 6R7I
  • PDBsum: 4D10 4D18 4QFT 4R14 4WSN 6R6H 6R7F 6R7H 6R7I
  • DIP: 32655
  • STRING: ENSP00000304102
• Other Databases: GeneCards:  COPS6  Malacards:  COPS6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0000338	protein deneddylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0000338	protein deneddylation	IEA	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881