• Gene id: 10979

Gene Summary

• Gene Symbol: FERMT2   Gene   UCSC   Ensembl
• Aliases: KIND2, MIG2, PLEKHC1, UNC112, UNC112B, mig-2
• Gene name: fermitin family member 2
• Alternate names: fermitin family homolog 2, PH domain-containing family C member 1, kindlin 2, mitogen inducible gene 2 protein, pleckstrin homology domain containing, family C (with FERM domain) member 1, pleckstrin homology domain containing, family C member 1,
• Gene location: 14q22.1 (48105252: 48146403)     Exons: 33     NC_000012.12
• OMIM: 607746

Protein Summary

• Protein general information: Q96AC1  
  • Name: Fermitin family homolog 2 (Kindlin 2) (Mitogen inducible gene 2 protein) (MIG 2) (Pleckstrin homology domain containing family C member 1) (PH domain containing family C member 1)
  • Length: 680  
  • Mass: 77861
  • Tissue specificity: Ubiquitous. Found in numerous tumor tissues.
• Sequence:

  MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKT
  HWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKK
  KKKKLDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQ
  PITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
  AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPEL
  ADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEG
  MNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPR
  YLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST
  GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKL
  TSGWV

• Structural information:
  • Protein Domains: (189..66-)
    (/note="FERM-)
    (380..47-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR019749  IPR035963  IPR019748  IPR037843  IPR040790   IPR011993  IPR001849  IPR037837  
  • Prosite: PS50003
  • CDD: cd14473 cd01237
  • PDB: 2LGX 2LKO 2MSU 4F7H 6U4N
  • PDBsum: 2LGX 2LKO 2MSU 4F7H 6U4N
  • STRING: ENSP00000342858
• Other Databases: GeneCards:  FERMT2  Malacards:  FERMT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005925	focal adhesion	IBA	cellular component
GO:0030055	cell-substrate junction	IBA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0048041	focal adhesion assembly	ISS	biological process
GO:0016055	Wnt signaling pathway	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007160	cell-matrix adhesion	ISS	biological process
GO:0072657	protein localization to membrane	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	ISS	biological process
GO:0033622	integrin activation	IMP	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034329	cell junction assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0072657	protein localization to membrane	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0033622	integrin activation	IEA	biological process
GO:0001725	stress fiber	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0031674	I band	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0031258	lamellipodium membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

Diseases

Associated diseases	References
acute myeloid leukemia	PMID:22391155
Hypospermatogenesis	MIK: 28361989
Low sperm motility	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Low sperm motility			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray