• Gene id: 10978

Gene Summary

• Gene Symbol: CLP1   Gene   UCSC   Ensembl
• Aliases: HEAB, hClp1
• Gene name: cleavage factor polyribonucleotide kinase subunit 1
• Alternate names: polyribonucleotide 5'-hydroxyl-kinase Clp1, ATP/GTP-binding protein, cleavage and polyadenylation factor I subunit 1, homolog of yeast CFIA subunit Clp1p, polyadenylation factor Clp1, polynucleotide kinase Clp1, pre-mRNA cleavage complex II protein Clp1,
• Gene location: 11q12.1 (57657743: 57661864)     Exons: 3     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the Clp1 family. The encoded protein is a multifunctional kinase which is a component of the tRNA splicing endonuclease complex and a component of the pre-mRNA cleavage complex II. This protein is implicated in tRNA, mRNA, an
• OMIM: 300405

Protein Summary

• Protein general information: Q92989  
  • Name: Polyribonucleotide 5' hydroxyl kinase Clp1 (EC 2.7.1.78) (Polyadenylation factor Clp1) (Polynucleotide kinase Clp1) (Pre mRNA cleavage complex II protein Clp1)
  • Length: 425  
  • Mass: 47646
• Sequence:

  MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQL
  SGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVRLGRRPTYVEL
  DVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSG
  CVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
  IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTE
  ENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIRFMDLK

• Structural information:
  • Interpro: IPR028606  IPR010655  IPR038238  IPR032324  IPR038239   IPR032319  IPR027417  
  • STRING: ENSP00000434995
• Other Databases: GeneCards:  CLP1  Malacards:  CLP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006378	mRNA polyadenylation	IBA	biological process
GO:0051731	polynucleotide 5'-hydroxyl-kinase activity	IBA	molecular function
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IBA	biological process
GO:0006396	RNA processing	IBA	biological process
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IDA	biological process
GO:0000214	tRNA-intron endonuclease complex	IDA	cellular component
GO:0051736	ATP-dependent polyribonucleotide 5'-hydroxyl-kinase activity	IDA	molecular function
GO:0051733	polydeoxyribonucleotide kinase activity	IDA	molecular function
GO:0035087	siRNA loading onto RISC involved in RNA interference	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0030423	targeting of mRNA for destruction involved in RNA interference	IMP	biological process
GO:0021695	cerebellar cortex development	IMP	biological process
GO:0021695	cerebellar cortex development	IMP	biological process
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IMP	biological process
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IMP	biological process
GO:0051736	ATP-dependent polyribonucleotide 5'-hydroxyl-kinase activity	IMP	molecular function
GO:0051736	ATP-dependent polyribonucleotide 5'-hydroxyl-kinase activity	IMP	molecular function
GO:0005524	ATP binding	TAS	molecular function
GO:0005849	mRNA cleavage factor complex	IEA	cellular component
GO:0031124	mRNA 3'-end processing	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0051734	ATP-dependent polynucleotide kinase activity	IEA	molecular function
GO:0046404	ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity	IEA	molecular function
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021695	cerebellar cortex development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031124	mRNA 3'-end processing	IEA	biological process
GO:0005849	mRNA cleavage factor complex	IEA	cellular component
GO:0000214	tRNA-intron endonuclease complex	IEA	cellular component
GO:0006388	tRNA splicing, via endonucleolytic cleavage and ligation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0035087	siRNA loading onto RISC involved in RNA interference	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0051733	polydeoxyribonucleotide kinase activity	IEA	molecular function
GO:0051736	ATP-dependent polyribonucleotide 5'-hydroxyl-kinase activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Pontocerebellar hypoplasia	KEGG:H00897
Pontocerebellar hypoplasia	KEGG:H00897
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray