• Gene id: 10975

Gene Summary

• Gene Symbol: UQCR11   Gene   UCSC   Ensembl
• Aliases: 0710008D09Rik, QCR10, UQCR
• Gene name: ubiquinol-cytochrome c reductase, complex III subunit XI
• Alternate names: cytochrome b-c1 complex subunit 10, complex III subunit 10, complex III subunit XI, ubiquinol-cytochrome c reductase complex 6.4 kDa protein, ubiquinol-cytochrome c reductase, 6.4kDa subunit,
• Gene location: 19p13.3 (1605461: 1597168)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes the smallest known component of the ubiquinol-cytochrome c reductase complex, which forms part of the mitochondrial respiratory chain. The encoded protein may function as a binding factor for the iron-sulfur protein in this complex. [pro
• OMIM: 609711

Protein Summary

• Protein general information: O14957  
  • Name: Cytochrome b c1 complex subunit 10 (Complex III subunit 10) (Complex III subunit XI) (Ubiquinol cytochrome c reductase complex 6.4 kDa protein)
  • Length: 56  
  • Mass: 6570
• Sequence:

  MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

• Structural information:
  • Interpro: IPR029027  IPR015089  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000467262
• Other Databases: GeneCards:  UQCR11  Malacards:  UQCR11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008121	ubiquinol-cytochrome-c reductase activity	IBA	molecular function
GO:0008121	ubiquinol-cytochrome-c reductase activity	IEA	molecular function
GO:0009055	electron transfer activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881