• Gene id: 10974

Gene Summary

• Gene Symbol: ADIRF   Gene   UCSC   Ensembl
• Aliases: AFRO, APM2, C10orf116, apM-2
• Gene name: adipogenesis regulatory factor
• Alternate names: adipogenesis regulatory factor, adipogenesis factor rich in obesity, adipose most abundant gene transcript 2 protein, adipose specific 2, adipose-specific protein 2,
• Gene location: 10q23.2 (122788455: 122809719)     Exons: 9     NC_000006.12
• Gene summary(Entrez): APM2 gene is exclusively expressed in adipose tissue. Its function is currently unknown. [provided by RefSeq, Jul 2008]

Protein Summary

• Protein general information: Q15847  
  • Name: Adipogenesis regulatory factor (Adipogenesis factor rich in obesity) (Adipose most abundant gene transcript 2 protein) (Adipose specific protein 2) (apM 2)
  • Length: 76  
  • Mass: 7855
  • Tissue specificity: Expressed in adipose tissue (at protein level). Highly expressed in omental and subcutaneous adipose tissues. Expressed in heart, cornea, liver, kidney and spleen. {ECO
• Sequence:

  MASKGLQDLKQQVEGTAQEAVSAAGAAAQQVVDQATEAGQKAMDQLAKTTQETIDKTANQASDTFSGIGKKFGLL
  K

• Structural information:
  • Interpro: IPR034450  
  • STRING: ENSP00000361083
• Other Databases: GeneCards:  ADIRF  Malacards:  ADIRF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045600	positive regulation of fat cell differentiation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0072719	cellular response to cisplatin	IDA	biological process
GO:0071478	cellular response to radiation	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IDA	biological process
GO:2001023	regulation of response to drug	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray