• Gene id: 10972

Gene Summary

• Gene Symbol: TMED10   Gene   UCSC   Ensembl
• Aliases: P24(DELTA), S31I125, S31III125, TMP21, Tmp-21-I, p23, p24d1
• Gene name: transmembrane p24 trafficking protein 10
• Alternate names: transmembrane emp24 domain-containing protein 10, 21 kDa transmembrane trafficking protein, p24 family protein delta-1, p24delta, p24delta1, testicular tissue protein Li 206, transmembrane emp24-like trafficking protein 10, transmembrane protein Tmp21,
• Gene location: 14q24.3 (75176611: 75131468)     Exons: 5     NC_000014.9
• Gene summary(Entrez): This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking. The protein is also a memb
• OMIM: 605406

SNPs

rs700519

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.51215771G>A
NC_000015.9   g.51507968G>A
NG_007982.1   g.127828C>T
NM_000103.4   c.790C>T
NM_000103.3   c.790C>T
NM_031226.3   c.790C>T
NM_031226.2   c.790C>T
NM_001347255.2   c.790C>T
NM_001347255.1   c.790C>T
NM_001347256.2   c.790C>T
NM_001347256.1   c.

Protein Summary

• Protein general information: P49755  
  • Name: Transmembrane emp24 domain containing protein 10 (21 kDa transmembrane trafficking protein) (S31III125) (S31I125) (Tmp 21 I) (Transmembrane protein Tmp21) (p23) (p24 family protein delta 1) (p24delta1) (p24delta)
  • Length: 219  
  • Mass: 24976
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLK
  ITDSAGHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVE
  LRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE

• Structural information:
  • Protein Domains: (41..19-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR009038  IPR015720  
  • Prosite: PS50866
  • STRING: ENSP00000303145
• Other Databases: GeneCards:  TMED10  Malacards:  TMED10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045055	regulated exocytosis	ISS	biological process
GO:0005801	cis-Golgi network	ISS	cellular component
GO:0048199	vesicle targeting, to, from or within Golgi	ISS	biological process
GO:0016021	integral component of membrane	ISS	cellular component
GO:0042589	zymogen granule membrane	ISS	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0030137	COPI-coated vesicle	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0070765	gamma-secretase complex	IDA	cellular component
GO:0035964	COPI-coated vesicle budding	IDA	biological process
GO:0006886	intracellular protein transport	IDA	biological process
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0048205	COPI coating of Golgi vesicle	TAS	biological process
GO:0035459	vesicle cargo loading	TAS	biological process
GO:0030140	trans-Golgi network transport vesicle	ISS	cellular component
GO:0030667	secretory granule membrane	ISS	cellular component
GO:0030137	COPI-coated vesicle	ISS	cellular component
GO:0019905	syntaxin binding	IPI	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	ISS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042589	zymogen granule membrane	IEA	cellular component
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0007030	Golgi organization	IEA	biological process
GO:0070765	gamma-secretase complex	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0042589	zymogen granule membrane	IEA	cellular component
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007030	Golgi organization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0048199	vesicle targeting, to, from or within Golgi	IEA	biological process
GO:0045055	regulated exocytosis	IEA	biological process
GO:0048199	vesicle targeting, to, from or within Golgi	IEA	biological process
GO:0045055	regulated exocytosis	IEA	biological process
GO:0043279	response to alkaloid	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005801	cis-Golgi network	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0001822	kidney development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:1902003	regulation of amyloid-beta formation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Alzheimer's disease	PMID:18652896
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)