Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 10971
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol YWHAQ   Gene   UCSC   Ensembl
Aliases 14-3-3, 1C5, HS1
Gene name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
Alternate names 14-3-3 protein theta, 14-3-3 protein T-cell, 14-3-3 protein tau, protein, theta, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide,
Gene location 2p25.1 (9631054: 9583966)     Exons: 6     NC_000002.12
Gene summary(Entrez) This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to th
OMIM 609009

Protein Summary
Protein general information P27348  

Name: 14 3 3 protein theta (14 3 3 protein T cell) (14 3 3 protein tau) (Protein HS1)

Length: 245  Mass: 27,764

Sequence MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKK
LQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQ
EAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNL
TLWTSDSAGEECDAAEGAEN
Structural information
Interpro:  IPR000308  IPR023409  IPR036815  IPR023410  
Prosite:   PS00796 PS00797

PDB:  		 2BTP 5IQP
PDBsum:   2BTP 5IQP

DIP:  
27584
MINT:  
STRING:   ENSP00000238081
Other Databases GeneCards:  YWHAQ  Malacards:  YWHAQ

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0006605 protein targeting
 IEA biological process
GO:0007264 small GTPase mediated sig
nal transduction
 IEA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0016020 membrane
 IDA cellular component
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030659 cytoplasmic vesicle membr
ane
 TAS cellular component
GO:0034766 negative regulation of io
n transmembrane transport
 IEA biological process
GO:0043234 protein complex
 IDA cellular component
GO:0044325 ion channel binding
 IEA molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0047485 protein N-terminus bindin
g
 IPI molecular function
GO:0061024 membrane organization
 TAS biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0071889 14-3-3 protein binding
 IEA molecular function
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IEA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005739 mitochondrion
 IEA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0006605 protein targeting
 IEA biological process
GO:0007264 small GTPase mediated sig
nal transduction
 IEA biological process
GO:0008022 protein C-terminus bindin
g
 IEA molecular function
GO:0016020 membrane
 IDA cellular component
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0019904 protein domain specific b
inding
 IEA molecular function
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030659 cytoplasmic vesicle membr
ane
 TAS cellular component
GO:0034766 negative regulation of io
n transmembrane transport
 IEA biological process
GO:0043234 protein complex
 IEA cellular component
GO:0043234 protein complex
 IDA cellular component
GO:0044325 ion channel binding
 IEA molecular function
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0047485 protein N-terminus bindin
g
 IEA molecular function
GO:0047485 protein N-terminus bindin
g
 IPI molecular function
GO:0061024 membrane organization
 TAS biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0071889 14-3-3 protein binding
 IEA molecular function
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005925 focal adhesion
 IDA cellular component
GO:0016020 membrane
 IDA cellular component
GO:0021762 substantia nigra developm
ent
 IEP biological process
GO:0030659 cytoplasmic vesicle membr
ane
 TAS cellular component
GO:0043234 protein complex
 IDA cellular component
GO:0045892 negative regulation of tr
anscription, DNA-template
d
 IDA biological process
GO:0047485 protein N-terminus bindin
g
 IPI molecular function
GO:0061024 membrane organization
 TAS biological process
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:0070062 extracellular exosome
 IDA cellular component
GO:1900740 positive regulation of pr
otein insertion into mito
chondrial membrane involv
ed in apoptotic signaling
pathway
 TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa04110Cell cycle
hsa04114Oocyte meiosis
hsa05203Viral carcinogenesis
hsa05161Hepatitis B
hsa05160Hepatitis C

Diseases

Expand All | Collapse All
Associated diseases References
Cancer (breast) GAD: 18950845
Sertoli cell only syndrome (SCOS) MIK: 21112954
Cryptorchidism MIK: 28606200
Sertoli cell-only syndrome MIK: 21112954
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21112954 Sertoli ce
ll-only sy
ndrome

Male infertility
Show abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract