• Gene id: 10965

Gene Summary

• Gene Symbol: ACOT2   Gene   UCSC   Ensembl
• Aliases: CTE-IA, CTE1A, MTE1, PTE2, PTE2A, ZAP128
• Gene name: acyl-CoA thioesterase 2
• Alternate names: acyl-coenzyme A thioesterase 2, mitochondrial, acyl-coenzyme A thioester hydrolase 2a, long-chain acyl-CoA thioesterase 2, mitochondrial acyl-CoA thioesterase 1, peroxisomal long-chain acyl-coA thioesterase 2,
• Gene location: 14q24.3 (73567619: 73575657)     Exons: 5     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the acyl-CoA thioesterase protein family, and is one of four acyl-CoA hydrolase genes located in a cluster on chromosome 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• OMIM: 606926

Protein Summary

• Protein general information: P49753  
  • Name: Acyl coenzyme A thioesterase 2, mitochondrial (Acyl CoA thioesterase 2) (EC 3.1.2.2) (Acyl coenzyme A thioester hydrolase 2a) (CTE Ia) (Long chain acyl CoA thioesterase 2) (ZAP128)
  • Length: 483  
  • Mass: 53218
  • Tissue specificity: Strongest expression in heart, liver, muscle and kidney. Weak in placenta and pancreas. {ECO
• Sequence:

  MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPARMAATLILEPAGRC
  CWDEPVRIAVRGLAPEQPVTLRASLRDEKGALFQAHARYRADTLGELDLERAPALGGSFAGLEPMGLLWALEPEK
  PLVRLVKRDVRTPLAVELEVLDGHDPDPGRLLCQTRHERYFLPPGVRREPVRVGRVRGTLFLPPEPGPFPGIVDM
  FGTGGGLLEYRASLLAGKGFAVMALAYYNYEDLPKTMETLHLEYFEEAMNYLLSHPEVKGPGVGLLGISKGGELC
  LSMASFLKGITAAVVINGSVANVGGTLHYKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVER
  AESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGHYIEPPYFPLCRASLHALVGSPIIWGGEP
  RAHAMAQVDAWKQLQTFFHKHLGGHEGTIPSKV

• Structural information:
  • Interpro: IPR029058  IPR016662  IPR014940  IPR006862  IPR042490  
  • PDB: 3HLK
  • PDBsum: 3HLK
  • STRING: ENSP00000238651
• Other Databases: GeneCards:  ACOT2  Malacards:  ACOT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006637	acyl-CoA metabolic process	IDA	biological process
GO:0006637	acyl-CoA metabolic process	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0047617	acyl-CoA hydrolase activity	IDA	molecular function
GO:0000038	very long-chain fatty acid metabolic process	IDA	biological process
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0047617	acyl-CoA hydrolase activity	IBA	molecular function
GO:0006637	acyl-CoA metabolic process	IEA	biological process
GO:0016790	thiolester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0102991	myristoyl-CoA hydrolase activity	IEA	molecular function
GO:0016290	palmitoyl-CoA hydrolase activity	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006625	protein targeting to peroxisome	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01040	Biosynthesis of unsaturated fatty acids
hsa00062	Fatty acid elongation
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881