• Gene id: 10964

Gene Summary

• Gene Symbol: IFI44L   Gene   UCSC   Ensembl
• Aliases: C1orf29, GS3686
• Gene name: interferon induced protein 44 like
• Alternate names: interferon-induced protein 44-like,
• Gene location: 1p31.1 (78620411: 78646144)     Exons: 10     NC_000001.11
• OMIM: 613975

Protein Summary

• Protein general information: Q53G44  
  • Name: Interferon induced protein 44 like
  • Length: 452  
  • Mass: 51322
• Sequence:

  MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYINLHES
  STEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLKLRFYGHRQY
  LECEVFRVEGIKDNLDDIKRIIKAREHRNRLLADIRDYRPYADLVSEIRILLVGPVGSGKSSFFNSVKSIFHGHV
  TGQAVVGSDITSITERYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIPHILKGCMPDRYQFNSRKPIT
  PEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCGIAYVALLTKVDDCSEVLQDNFLNMS
  RSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILSALRQMLRAADDFLEDLPLEETGAIERALQP
  CI

• Structural information:
  • Protein Domains: (1..15-)
    (/note="TLDc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01234"-)
  • Interpro: IPR006073  IPR024644  IPR027417  
  • Prosite: PS51886
  • STRING: ENSP00000359787
• Other Databases: GeneCards:  IFI44L  Malacards:  IFI44L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0051607	defense response to virus	IDA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R