• Gene id: 10963

Gene Summary

• Gene Symbol: STIP1   Gene   UCSC   Ensembl
• Aliases: HEL-S-94n, HOP, IEF-SSP-3521, P60, STI1, STI1L
• Gene name: stress induced phosphoprotein 1
• Alternate names: stress-induced-phosphoprotein 1, Hsp70/Hsp90-organizing protein, NY-REN-11 antigen, epididymis secretory sperm binding protein Li 94n, hsc70/Hsp90-organizing protein, renal carcinoma antigen NY-REN-11, transformation-sensitive protein IEF SSP 3521,
• Gene location: 11q13.1 (64185271: 64204547)     Exons: 15     NC_000011.10
• Gene summary(Entrez): STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substra
• OMIM: 605063

Protein Summary

• Protein general information: P31948  
  • Name: Stress induced phosphoprotein 1 (STI1) (Hsc70/Hsp90 organizing protein) (Hop) (Renal carcinoma antigen NY REN 11) (Transformation sensitive protein IEF SSP 3521)
  • Length: 543  
  • Mass: 62639
• Sequence:

  MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGY
  SRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDP
  TYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQA
  LKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
  KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGD
  YPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDV
  YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNP
  VIAQKIQKLMDVGLIAIR

• Structural information:
  • Protein Domains: (130..16-)
    (/note="STI1-1)
    (492..53-)
    (/note="STI1-2")
  • Interpro: IPR041243  IPR006636  IPR013026  IPR011990  IPR013105   IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 1ELR 1ELW 2LNI 2NC9 3ESK 3FWV
  • PDBsum: 1ELR 1ELW 2LNI 2NC9 3ESK 3FWV
  • DIP: 41085
  • STRING: ENSP00000351646
• Other Databases: GeneCards:  STIP1  Malacards:  STIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051879	Hsp90 protein binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0098761	cellular response to interleukin-7	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0101031	chaperone complex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05020	Prion diseases

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R