• Gene id: 10962

Gene Summary

• Gene Symbol: MLLT11   Gene   UCSC   Ensembl
• Aliases: AF1Q
• Gene name: MLLT11 transcription factor 7 cofactor
• Alternate names: protein AF1q, ALL1 fused gene from chromosome 1q, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11, myeloid/lymphoid or mixed-lineage leukemia; translocated to, 11,
• Gene location: 1q21.3 (160339569: 160249082)     Exons: 15     NC_000005.10
• Gene summary(Entrez): The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in
• OMIM: 604684

Protein Summary

• Protein general information: Q13015  
  • Name: Protein AF1q
  • Length: 90  
  • Mass: 10061
  • Tissue specificity: Expressed in myoepithelial cells of normal breast tissue (at protein level) (PubMed
• Sequence:

  MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFW
  RAPIASIHSFELDLL

• Structural information:
  • Interpro: IPR026778  IPR033461  
  • STRING: ENSP00000357917
• Other Databases: GeneCards:  MLLT11  Malacards:  MLLT11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051901	positive regulation of mitochondrial depolarization	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IBA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)