• Gene id: 10960

Gene Summary

• Gene Symbol: LMAN2   Gene   UCSC   Ensembl
• Aliases: C5orf8, GP36B, VIP36
• Gene name: lectin, mannose binding 2
• Alternate names: vesicular integral-membrane protein VIP36, epididymis secretory sperm binding protein, glycoprotein GP36b, vesicular integral protein of 36 kDa, vesicular integral-membrane protein 36,
• Gene location: 5q35.3 (1969551: 2697949)     Exons: 56     NC_000012.12
• Gene summary(Entrez): This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quali
• OMIM: 609551

Protein Summary

• Protein general information: Q12907  
  • Name: Vesicular integral membrane protein VIP36 (Glycoprotein GP36b) (Lectin mannose binding 2) (Vesicular integral membrane protein 36) (VIP36)
  • Length: 356  
  • Mass: 40229
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSSSMPLW
  DFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGS
  KDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLT
  VMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLK
  SPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQERNKRFY

• Structural information:
  • Protein Domains: (52..27-)
    (/note="L-type-lectin-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00658"-)
  • Interpro: IPR013320  IPR005052  IPR035664  
  • Prosite: PS51328
  • CDD: cd06901
  • STRING: ENSP00000303366
• Other Databases: GeneCards:  LMAN2  Malacards:  LMAN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005537	mannose binding	IBA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0005537	mannose binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050766	positive regulation of phagocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq